From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1436 [new locus tag: SACOL_RS07315 ]
  • pan locus tag?: SAUPAN003815000
  • symbol: SACOL1436
  • pan gene symbol?: msa
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1436 [new locus tag: SACOL_RS07315 ]
  • symbol: SACOL1436
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1449092..1449493
  • length: 402
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAATATCTTATCCTTAGTTTAGTTGCTAATTTATTAGTTTTCGGTGTATTATCTGCA
    ATTGGATTAAATATTAATATTTTAGCAGCAATGATGATTGTATTAGTGATTCCGATAATG
    ATTTCTGGGATACTATTTTTCAAAACTAATATTGATAAAACATACATATTTTTTAACATC
    ATATTTATCGACTTTTATTACTATATTTACAATGTACATTTAATGACTTTGCCAAAGTTT
    AATAATTATATTAAAGCAGAGATGATGGAATTAGAAGATATTGATGTATTAATTACAAGT
    AAAGATTTTGGATTTGATGAAATTCTGTTTTATACATTATATTTGTTGTTAATTCTTATC
    GTTTTATATTATTTGAAAAAGCAAGTAAAGCATAAAATCTAA
    60
    120
    180
    240
    300
    360
    402

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1436 [new locus tag: SACOL_RS07315 ]
  • symbol: SACOL1436
  • description: hypothetical protein
  • length: 133
  • theoretical pI: 7.62953
  • theoretical MW: 15657
  • GRAVY: 1.02105

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Protein msa (Modulator of sarA) 
  • PFAM:

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.196
    • Ymax_pos: 13
    • Cmax: 0.169
    • Cmax_pos: 31
    • Smax: 0.478
    • Smax_pos: 4
    • Smean: 0.382
    • D: 0.269
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGILFFKTNIDKTYIFFNIIFIDFYYYIYNVHLMTLPKFNNYIKAEMMELEDIDVLITSKDFGFDEILFYTLYLLLILIVLYYLKKQVKHKI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

H De Lencastre, S W Wu, M G Pinho, A M Ludovice, S Filipe, S Gardete, R Sobral, S Gill, M Chung, A Tomasz
Antibiotic resistance as a stress response: complete sequencing of a large number of chromosomal loci in Staphylococcus aureus strain COL that impact on the expression of resistance to methicillin.
Microb. Drug Resist.: 1999, 5(3);163-75
[PubMed:10566865] [WorldCat.org] (P p)