From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003815000
  • symbol?: msa
  • description?: protein msa

      descriptions from strain specific annotations:

    • protein msa
    • Protein msa (Modulator of sarA)
    • modulator of SarA, Msa
  • strand?: -
  • coordinates?: 4106479..4106880
  • synteny block?: BlockID0028720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1355
    08BA02176:
    C248_1441 (msa)
    11819-97:
    MS7_1357
    71193:
    ST398NM01_1403
    ECT-R 2:
    ECTR2_1258
    ED133:
    SAOV_1411c
    ED98:
    SAAV_1384
    HO 5096 0412:
    SAEMRSA15_12640
    JH1:
    SaurJH1_1491
    JH9:
    SaurJH9_1462
    JKD6008:
    SAA6008_01365 (msa)
    JKD6159:
    SAA6159_01268 (msa)
    LGA251:
    SARLGA251_13180 (msa)
    M013:
    M013TW_1346
    MRSA252:
    SAR1413
    MSHR1132:
    SAMSHR1132_12420
    MSSA476:
    SAS1342
    Mu3:
    SAHV_1389
    Mu50:
    SAV1401
    MW2:
    MW1289
    RF122:
    SAB1257c
    ST398:
    SAPIG1403
    T0131:
    SAT0131_01476
    TCH60:
    HMPREF0772_11808
    TW20:
    SATW20_14000 (msa)
    USA300_TCH1516:
    USA300HOU_1336
    VC40:
    SAVC_06250

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGILFFKTNIDKTYIFFNI
    N315            MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGILFFKTNIDKTYIFFNI
    NCTC8325        MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGILFFKTNIDKTYIFFNI
    Newman          MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGILFFKTNIDKTYIFFNI
    USA300_FPR3757  MKYLILSLVANLLVFGVLSAIGLNINILAAMMIVLVIPIMISGILFFKTNIDKTYIFFNI
                    ************************************************************

    COL             IFIDFYYYIYNVHLMTLPKFNNYIKAEMMELEDIDVLITSKDFGFDEILFYTLYLLLILI
    N315            IFIDFYYYIYNVHLMTLPKFNNYIKAEMMELEDIDVLITSKDFGFDEILFYTLYLLLILI
    NCTC8325        IFIDFYYYIYNVHLMTLPKFNNYIKAEMMELEDIDVLITSKDFGFDEILFYTLYLLLILI
    Newman          IFIDFYYYIYNVHLMTLPKFNNYIKAEMMELEDIDVLITSKDFGFDEILFYTLYLLLILI
    USA300_FPR3757  IFIDFYYYIYNVHLMTLPKFNNYIKAEMMELEDIDVLITSKDFGFDEILFYTLYLLLILI
                    ************************************************************

    COL             VLYYLKKQVKHKI
    N315            VLYYLKKQVKHKI
    NCTC8325        VLYYLKKQVKHKI
    Newman          VLYYLKKQVKHKI
    USA300_FPR3757  VLYYLKKQVKHKI
                    *************