From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1553 [new locus tag: SACOL_RS07915 ]
  • pan locus tag?: SAUPAN004046000
  • symbol: SACOL1553
  • pan gene symbol?:
  • synonym:
  • product: glyoxalase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1553 [new locus tag: SACOL_RS07915 ]
  • symbol: SACOL1553
  • product: glyoxalase
  • replicon: chromosome
  • strand: -
  • coordinates: 1589708..1590079
  • length: 372
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGAAAAGTTAAATCAAGTTATGTTATATGTTGATGATGTCGAAAAAGCGAAAGCATTT
    TGGACAGAAACTTTAGAATTTGTTGTTGTAAGTGAAACACCGTTAGCTGAGGACTATGTT
    GCAGTTGAAGTATCACCTACCAAAGATGCTGAAACGTCATTGACGATTATGGCAAAAGAA
    TTTATTGAAAAGCATAGCCCGGAAGTGAACCTAGGAACACCATCTTTAATGTTTAAAGAG
    AAAAACTTTGATGCATTATACTCAAAATTAAATGATTTAGGTTTAACTGGGCATGATATA
    GTAGAAATGAATGGTCAACGTGTATTTAATTTTCAAGATGGCCAAGGTAACTATTTTGCA
    GTTAGTGACTAA
    60
    120
    180
    240
    300
    360
    372

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1553 [new locus tag: SACOL_RS07915 ]
  • symbol: SACOL1553
  • description: glyoxalase
  • length: 123
  • theoretical pI: 4.1167
  • theoretical MW: 13890.6
  • GRAVY: -0.255285

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    methylmalonyl-CoA epimerase (TIGR03081; EC 5.1.99.1; HMM-score: 16.4)
  • TheSEED:  
    Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 
  • PFAM:
    Glyoxalase (CL0104) Glyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 32.6)
    Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 26)
    Glyoxalase_4; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF13669; HMM-score: 16.2)
    no clan definedDUF2481; Protein of unknown function (DUF2481) (PF10654; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.122
    • Ymax_pos: 37
    • Cmax: 0.181
    • Cmax_pos: 37
    • Smax: 0.142
    • Smax_pos: 16
    • Smean: 0.092
    • D: 0.11
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEKLNQVMLYVDDVEKAKAFWTETLEFVVVSETPLAEDYVAVEVSPTKDAETSLTIMAKEFIEKHSPEVNLGTPSLMFKEKNFDALYSKLNDLGLTGHDIVEMNGQRVFNFQDGQGNYFAVSD

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 876 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 35.81 h [5]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]