From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004046000
  • symbol?:
  • description?: glyoxalase/bleomycin resistance protein/dioxygenase

      descriptions from strain specific annotations:

    • glyoxalase/bleomycin resistance protein/dioxygenase
    • glyoxalase family protein
    • Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein
    • lactoylglutathione lysase
    • Lactoylglutathione lyase
  • strand?: -
  • coordinates?: 4332186..4332557
  • synteny block?: BlockID0030830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1466
    08BA02176:
    C248_1551
    11819-97:
    MS7_1527
    71193:
    ST398NM01_1575
    ECT-R 2:
    ECTR2_1360
    ED133:
    SAOV_1511
    ED98:
    SAAV_1500
    HO 5096 0412:
    SAEMRSA15_14310
    JH1:
    SaurJH1_1598
    JH9:
    SaurJH9_1566
    JKD6008:
    SAA6008_01479
    JKD6159:
    SAA6159_01438
    LGA251:
    SARLGA251_14170
    M013:
    M013TW_1525
    MRSA252:
    SAR1586
    MSHR1132:
    SAMSHR1132_13480
    MSSA476:
    SAS1449
    Mu3:
    SAHV_1497
    Mu50:
    SAV1509
    MW2:
    MW1463
    RF122:
    SAB1371c
    ST398:
    SAPIG1575
    T0131:
    SAT0131_01603 (cysM)
    TCH60:
    HMPREF0772_11632
    TW20:
    SATW20_15070
    USA300_TCH1516:
    USA300HOU_1511
    VC40:
    SAVC_06795

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKLNQVMLYVDDVEKAKAFWTETLEFVVVSETPLAEDYVAVEVSPTKDAETSLTIMAKE
    N315            MEKLNQVMLYVDDVEKAKAFWTETLEFVVVSETPLAEDYVAVEVSPTKDAETSLTIMAKE
    NCTC8325        MEKLNQVMLYVDDVEKAKAFWTETLEFVVVSETPLAEDYVAVEVSPTKDAETSLTIMAKE
    Newman          MEKLNQVMLYVDDVEKAKAFWTETLEFVVVSETPLAEDYVAVEVSPTKDAETSLTIMAKE
    USA300_FPR3757  MEKLNQVMLYVDDVEKAKAFWTETLEFVVVSETPLAEDYVAVEVSPTKDAETSLTIMAKE
                    ************************************************************

    COL             FIEKHSPEVNLGTPSLMFKEKNFDALYSKLNDLGLTGHDIVEMNGQRVFNFQDGQGNYFA
    N315            FIEKHSPEVNLGTPSLMFKEKNFDALYSKLNDLGLTGHDIVEMDGQRVFNFQDGQGNYFA
    NCTC8325        FIEKHSPEVNLGTPSLMFKEKNFDALYSKLNDLGLTGHDIVEMNGQRVFNFQDGQGNYFA
    Newman          FIEKHSPEVNLGTPSLMFKEKNFDALYSKLNDLGLTGHDIVEMNGQRVFNFQDGQGNYFA
    USA300_FPR3757  FIEKHSPEVNLGTPSLMFKEKNFDALYSKLNDLGLTGHDIVEMNGQRVFNFQDGQGNYFA
                    *******************************************:****************

    COL             VSD
    N315            VSD
    NCTC8325        VSD
    Newman          VSD
    USA300_FPR3757  VSD
                    ***