From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1567 [new locus tag: SACOL_RS07980 ]
  • pan locus tag?: SAUPAN004077000
  • symbol: xseB
  • pan gene symbol?: xseB
  • synonym:
  • product: exodeoxyribonuclease VII small subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1567 [new locus tag: SACOL_RS07980 ]
  • symbol: xseB
  • product: exodeoxyribonuclease VII small subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 1603544..1603774
  • length: 231
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGACTAAAGAAACGCAAAGTTTTGAAGAAATGATGCAAGAATTAGAGCAAATTGTTCAA
    AAATTAGATAATGAAACAGTATCTTTAGAGGAATCATTAGATTTATATCAACGTGGTATG
    AAACTATCAGCAGCTTGTGACACAACTTTAAAAAATGCCGAAAAAAAGGTGAATGACTTA
    ATAAAAGAAGAAGCTGAGGATGTAAAAAATGACGAATCTACCGATGAATAA
    60
    120
    180
    231

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1567 [new locus tag: SACOL_RS07980 ]
  • symbol: XseB
  • description: exodeoxyribonuclease VII small subunit
  • length: 76
  • theoretical pI: 3.9341
  • theoretical MW: 8759.64
  • GRAVY: -0.977632

Function[edit source | edit]

  • reaction:
    EC 3.1.11.6?  ExPASy
    Exodeoxyribonuclease VIIExonucleolytic cleavage in either 5'- to 3'- or 3'- to 5'-direction to yield nucleoside 5'-phosphates
  • TIGRFAM:
    Genetic information processingDNA metabolismDegradation of DNAexodeoxyribonuclease VII, small subunit (TIGR01280; EC 3.1.11.6; HMM-score: 81)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidespolysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobaltochelatase, CobN subunit (TIGR02257; EC 6.6.1.2; HMM-score: 11)
  • TheSEED:  
    DNA MetabolismDNA repairDNA repair, bacterial Exodeoxyribonuclease VII small subunit (EC 3.1.11.6) 
  • PFAM:
    no clan definedExonuc_VII_S; Exonuclease VII small subunit (PF02609; HMM-score: 76.1)
    DASH_Dad2; DASH complex subunit Dad2 (PF08654; HMM-score: 13.8)
    ADIP; Afadin- and alpha -actinin-Binding (PF11559; HMM-score: 13.2)
    DUF4359; Domain of unknown function (DUF4359) (PF14271; HMM-score: 12.8)
    DUF1657; Protein of unknown function (DUF1657) (PF07870; HMM-score: 12.7)
    DUF2120; Uncharacterized protein conserved in archaea (DUF2120) (PF09893; HMM-score: 12)
    Med4; Vitamin-D-receptor interacting Mediator subunit 4 (PF10018; HMM-score: 10.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.125
    • Ymax_pos: 54
    • Cmax: 0.114
    • Cmax_pos: 56
    • Smax: 0.201
    • Smax_pos: 43
    • Smean: 0.105
    • D: 0.117
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTKETQSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDLIKEEAEDVKNDESTDE

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]
    quantitative data / protein copy number per cell: 536 [2]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  2. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]