From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004077000
  • symbol?: xseB
  • description?: exodeoxyribonuclease VII small subunit

      descriptions from strain specific annotations:

    • exodeoxyribonuclease VII small subunit
    • putative exodeoxyribonuclease VII small subunit
    • exodeoxyribonuclease 7 small subunit
    • exodeoxyribonuclease VII, small subunit
  • strand?: -
  • coordinates?: 4359466..4359696
  • synteny block?: BlockID0031090
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1567 (xseB)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1481
    08BA02176:
    C248_1565
    11819-97:
    MS7_1540 (xseB)
    71193:
    ST398NM01_1588
    ECT-R 2:
    ECTR2_1374 (xseB)
    ED133:
    SAOV_1523 (xseB)
    ED98:
    SAAV_1515 (xseB)
    HO 5096 0412:
    SAEMRSA15_14430
    JH1:
    SaurJH1_1614
    JH9:
    SaurJH9_1581
    JKD6008:
    SAA6008_01492 (xseB)
    JKD6159:
    SAA6159_01458 (xseB)
    LGA251:
    SARLGA251_14290
    M013:
    M013TW_1538
    MRSA252:
    SAR1600
    MSHR1132:
    SAMSHR1132_13630
    MSSA476:
    SAS1461
    Mu3:
    SAHV_1510
    Mu50:
    SAV1522
    MW2:
    MW1475
    RF122:
    SAB1395c
    ST398:
    SAPIG1588 (xseB)
    T0131:
    SAT0131_01616
    TCH60:
    HMPREF0772_11618 (xseB)
    TW20:
    SATW20_15190
    USA300_TCH1516:
    USA300HOU_1524 (xseB)
    VC40:
    SAVC_06860

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKETQSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDL
    N315            MTKETQSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDL
    NCTC8325        MTKETQSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDL
    USA300_FPR3757  MTKETQSFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDL
                    ************************************************************

    COL             IKEEAEDVKNDESTDE
    N315            IKEEAEDVKNDESTDE
    NCTC8325        IKEEAEDVKNDESTDE
    USA300_FPR3757  IKEEAEDVKNDESTDE
                    ****************