From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003607000
  • symbol?: mutL
  • description?: DNA mismatch repair protein

      descriptions from strain specific annotations:

    • DNA mismatch repair protein
    • DNA mismatch repair protein MutL
    • DNA mismatch repair protein HexB
    • DNA mismatch repair protein mutL. domain protein
    • pseudogene
  • strand?: +
  • coordinates?: 3948413..3949581
  • synteny block?: BlockID0026780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1316 (mutL)
    N315:
    SA1138 (mutL)
    NCTC8325:
    Newman:
    NWMN_1205 (mutL)
    USA300_FPR3757:
    04-02981:
    SA2981_1254 (mutL)
    08BA02176:
    C248_1330 (mutL)
    11819-97:
    MS7_1254 (mutL)
    71193:
    ST398NM01_1299
    ECT-R 2:
    ECTR2_1152 (mutL)
    ED133:
    SAOV_1298 (hexB)
    ED98:
    SAAV_1271 (mutL)
    HO 5096 0412:
    SAEMRSA15_11310 (mutL)
    JH1:
    SaurJH1_1382 (mutL)
    JH9:
    SaurJH9_1356
    JKD6008:
    SAA6008_01251 (mutL)
    JKD6159:
    SAA6159_01151 (mutL)
    LGA251:
    SARLGA251_12070 (mutL)
    M013:
    M013TW_1238
    MRSA252:
    SAR1272 (mutL)
    MSHR1132:
    SAMSHR1132_11390
    MSSA476:
    SAS1230 (mutL)
    Mu3:
    SAHV_1286 (mutL)
    Mu50:
    SAV1297 (mutL)
    MW2:
    MW1179 (mutL)
    RF122:
    SAB1158 (mutL)
    ST398:
    SAPIG1299
    T0131:
    SAT0131_01352
    TCH60:
    HMPREF0772_11932 (hexB)
    TW20:
    SATW20_12900 (mutL)
    USA300_TCH1516:
    USA300HOU_1228 (mutL)
    VC40:
    SAVC_05680 (mutL)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGKIKELQTSLANKIAAGEVVERPSSVVKELLENAIDAGATEISIEVEESGVQSIRVVDN
    N315            MGKIKELQTSLANKIAAGEVVERPSSVVKELLENAIDAGATEISIEVEESGVQSIRVVDN
    NCTC8325        MGKIKELQTSLANKIAAGEVVERPSSVVKELLENAIDAGATEISIEVEESGVQSIRVVDN
    Newman          MGKIKELQTSLANKIAAGEVVERPSSVVKELLENAIDAGATEISIEVEESGVQSIRVVDN
    USA300_FPR3757  MGKIKELQTSLANKIAAGEVVERPSSVVKELLENAIDAGATEISIEVEESGVQSIRVVDN
                    ************************************************************

    COL             GSGIEAEDLGLVFHRHATSKLDQDEDLFHIRTLGFRGEALASISSVAKVTLKTCTDNANG
    N315            GSGIEAEDLGLVFHRHATSKLDQDEDLFHIRTLGFRGEALASISSVAKVTLKTCTDNANG
    NCTC8325        GSGIEAEDLGLVFHRHATSKLDQDEDLFHIRTLGFRGEALASISSVAKVTLKTCTDNANG
    Newman          GSGIEAEDLGLVFHRHATSKLDQDEDLFHIRTLGFRGEALASISSVAKVTLKTCTDNANG
    USA300_FPR3757  GSGIEAEDLGLVFHRHATSKLDQDEDLFHIRTLGFRGEALASISSVAKVTLKTCTDNANG
                    ************************************************************

    COL             NEIYVENGEILNHKPAKAKKGTDILVESLFYNTPARLKYIKSLYTELGKITDIVNRMAMS
    N315            NEIYVENGEILNHKPAKAKKGTDILVESLFYNTPARLKYIKSLYTELGKITDIVNRMAMS
    NCTC8325        NEIYVENGEILNHKPAKAKKGTDILVESLFYNTPARLKYIKSLYTELGKITDIVNRMAMS
    Newman          NEIYVENGEILNHKPAKAKKGTDILVESLFYNTPARLKYIKSLYTELGKITDIVNRMAMS
    USA300_FPR3757  NEIYVENGEILNHKPAKAKKGTDILVESLFYNTPARLKYIKSLYTELGKITDIVNRMAMS
                    ************************************************************

    COL             HPDIRIALISDGKTMLSTNGSGRTNEVMAEIYGMKVARDLVHISGDTSDYHIEGFVAKPE
    N315            HPDIRIALISDGKTMLSTNGSGRTNEVMAEIYGMKVARDLVHISGDTSDYHIEGFVAKPE
    NCTC8325        HPDIRIALISDGKTMLSTNGSGRTNEVMAEIYGMKVARDLVHISGDTSDYHIEGFVAKPE
    Newman          HPDIRIALISDGKTMLSTNGSGRTNEVMAEIYGMKVARDLVHISGDTSDYHIEGFVAKPE
    USA300_FPR3757  HPDIRIALISDGKTMLSTNGSGRTNEVMAEIYGMKVARDLVHISGDTSDYHIEGFVAKPE
                    ************************************************************

    COL             HSRSNKHYISIFINGRYIKNFMLNKAILEGYHTLLTIGRFPICYINIEMDPILVDVNVHP
    N315            HSRSNKHYISIFINGRYIKNFMLNKAILEGYHTLLTIGRFPICYINIEMDPILVDVNVHP
    NCTC8325        HSRSNKHYISIFINGRYIKNFMLNKAILEGYHTLLTIGRFPICYINIEMDPILVDVNVHP
    Newman          HSRSNKHYISIFINGRYIKNFMLNKAILEGYHTLLTIGRFPICYINIEMDPILVDVNVHP
    USA300_FPR3757  HSRSNKHYISIFINGRYIKNFMLNKAILEGYHTLLTIGRFPICYINIEMDPILVDVNVHP
                    ************************************************************

    COL             TKLEVRLSKEEQLYQLIVSKIQEAFKDRILIPKNNLDYVPKKNKVLHSFEQQKIEFEQRQ
    N315            TKLEVRLSKEEQLYQLIVSKIQEAFKDRILIPKNNLDYVPKKNKVLYSFEQQKIEFEQRQ
    NCTC8325        TKLEVRLSKEEQLYQLIVSKIQEAFKDRILIPKNNLDYVPKKNKVLHSFEQQKIEFEQRQ
    Newman          TKLEVRLSKEEQLYQLIVSKIQEAFKDRILIPKNNLDYVPKKNKVLHSFEQQKIEFEQRQ
    USA300_FPR3757  TKLEVRLSKEEQLYQLIVSKIQEAFKDRILIPKNNLDYVPKKNKVLHSFEQQKIEFEQRQ
                    **********************************************:*************

    COL             NTENNQEKTFSSEESNSKPFMEENQNDEIVIKEDSYNPFVTKTSESLIADDESSGYNNTR
    N315            NTENNQEKTFSSEESNSKSFMAENQNDEIVIKEDSYNPFVTKTSESLITDDESSGYNNTR
    NCTC8325        NTENNQEKTFSSEESNSKPFMEENQNDEIVIKEDSYNPFVTKTSESLIADDESSGYNNTR
    Newman          NTENNQEKTFSSEESNSKPFMEENQNDEIVIKEDSYNPFVTKTSESLIADDESSGYNNTR
    USA300_FPR3757  NTENNQEKTFSSEESNSKPFMEENQNDEIVIKEDSYNPFVTKTSESLIADDESSGYNNTR
                    ******************.** **************************:***********

    COL             EKDEDYFKKQQEILQEMDQTFDSNDGTTVQNYENKASDDYYDVNDIKGTKSKDPKRRIPY
    N315            EKDEDYFKKQQEILQEMDQTFDSNEDASVQNYENKASDDYYDVNDIKGTKSKDPKRRIPY
    NCTC8325        EKDEDYFKKQQEILQEMDQTFDSNDGTTVQNYENKASDDYYDVNDIKGTKSKDPKRRIPY
    Newman          EKDEDYFKKQQEILQEMDQTFDSNDGTTVQNYENKASDDYYDVNDIKGTKSKDPKRRIPY
    USA300_FPR3757  EKDEDYFKKQQEILQEMDQTFDSNDGTTVQNYENKASDDYYDVNDIKGTKSKDPKRRIPY
                    ************************:.::********************************

    COL             MEIVGQVHGTYIIAQNEFGMYMIDQHAAQERIKYEYFRDKIGEVTNEVQDLLIPLTFHFS
    N315            MEIVGQVHGTYIIAQNEFGMYMIDQHAAQERIKYEYFRDKIGEVTNEVQDLLIPLTFHFS
    NCTC8325        MEIVGQVHGTYIIAQNEFGMYMIDQHAAQERIKYEYFRDKIGEVTNEVQDLLIPLTFHFS
    Newman          MEIVGQVHGTYIIAQNEFGMYMIDQHAAQERIKYEYFRDKIGEVTNEVQDLLIPLTFHFS
    USA300_FPR3757  MEIVGQVHGTYIIAQNEFGMYMIDQHAAQERIKYEYFRDKIGEVTNEVQDLLIPLTFHFS
                    ************************************************************

    COL             KDEQLVIDQYKNELQQVGIMLEHFGGHDYIVSSYPVWFPKDEVEEIIKDMIELILEEKKV
    N315            KDEQLVIDQYKNELQQVGIMLEHFGGHDYIVSSYPVWFPKDEVEEIIKDMIELILEEKKV
    NCTC8325        KDEQLVIDQYKNELQQVGIMLEHFGGHDYIVSSYPVWFPKDEVEEIIKDMIELILEEKKV
    Newman          KDEQLVIDQYKNELQQVGIMLEHFGGHDYIVSSYPVWFPKDEVEEIIKDMIELILEEKKV
    USA300_FPR3757  KDEQLVIDQYKNELQQVGIMLEHFGGHDYIVSSYPVWFPKDEVEEIIKDMIELILEEKKV
                    ************************************************************

    COL             DIKKLREDVAIMMSCKKSIKANHYLQKHEMSDLIDQLREAEDPFTCPHGRPIIINFSKYE
    N315            DIKKLREDVAIMMSCKKSIKANHYLQKHEMSDLIDQLREAEDPFTCPHGRPIIINFSKYE
    NCTC8325        DIKKLREDVAIMMSCKKSIKANHYLQKHEMSDLIDQLREAEDPFTCPHGRPIIINFSKYE
    Newman          DIKKLREDVAIMMSCKKSIKANHYLQKHEMSDLIDQLREAEDPFTCPHGRPIIINFSKYE
    USA300_FPR3757  DIKKLREDVAIMMSCKKSIKANHYLQKHEMSDLIDQLREAEDPFTCPHGRPIIINFSKYE
                    ************************************************************

    COL             LEKLFKRVM
    N315            LEKLFKRVM
    NCTC8325        LEKLFKRVM
    Newman          LEKLFKRVM
    USA300_FPR3757  LEKLFKRVM
                    *********