From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1647 [new locus tag: SACOL_RS08400 ]
  • pan locus tag?: SAUPAN004177000
  • symbol: SACOL1647
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1647 [new locus tag: SACOL_RS08400 ]
  • symbol: SACOL1647
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1678878..1679594
  • length: 717
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGTCGCAATATGCAGAAATGAGCCTAGTGTACGATCAATTGACTCAAGATCAACCATAT
    GAAAAATGGTTTGAAATTGTAAAAAATCACTGCAAAGATGAATCAAATATTTTAGATATT
    GGATGCGGTACTGGTAGTTTAACAGTTCAATTAGAAGCTTTAGGTAATGTTACTGGTATG
    GATTTAAGTGTTGATATGTTGACTGTTGCAGCTCAAAAATCAGCAAATGTAAATTGGCTT
    GAAGGAGATATGACATCTTTTGATTTGCAACAACAATTTGATATCATCACTATTTTTTGT
    GACTCTCTAAATTATTTGCAAGATGAAACTGCAGTGATTGAAACATTCATCAATGTTTAT
    CATCATCTGACTGATTCAGGTGTATTTATTTTTGATGTACATACTGTTTATAAAATGATG
    ACTTTGTTTAATAATCAAAGTTATATTGATGATAAAGGGGACATTTTTTTAGCATGGGAT
    GCTGTGCAAGGAGATTTACCTTTAAGTGTTTATCATGATATGACATTTTTCATTCGACAT
    GAAGATGAAACATATTCAAGATTTGATGAGTCTCATTTTCAGAGAACATTTGATGAAAAG
    ACATATTTGTCTTGGTTAGCTCAAGTTGGTTTTAAACATGTTGAAACATTTACTGATTTT
    AATATAGATGAACATAATGAAGATGCAGAAAGATTGTTTTTCATTGCGAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    717

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1647 [new locus tag: SACOL_RS08400 ]
  • symbol: SACOL1647
  • description: hypothetical protein
  • length: 238
  • theoretical pI: 4.09468
  • theoretical MW: 27701.7
  • GRAVY: -0.262605

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotinmalonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 48.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinoneubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 42.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphyllmagnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 34.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 33.5)
    MetabolismAmino acid biosynthesisAspartate familymethionine biosynthesis protein MetW (TIGR02081; HMM-score: 32.5)
    Genetic information processingProtein fateProtein modification and repairprotein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 25.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinonedemethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 24.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsputative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 22.1)
    Genetic information processingProtein synthesistRNA and rRNA base modificationribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 21.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 20.9)
    Unknown functionEnzymes of unknown specificityputative methylase (TIGR00537; HMM-score: 17.8)
    Genetic information processingTranscriptionRNA processing3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 17.8)
    Genetic information processingProtein synthesistRNA and rRNA base modification3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 17.8)
    Genetic information processingProtein fateProtein modification and repairmethyltransferase, HemK family (TIGR00536; HMM-score: 17.3)
    methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 15.8)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 15.7)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationprotein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 14.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesputative sugar O-methyltransferase (TIGR04371; EC 2.1.1.-; HMM-score: 14.3)
    2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 11.8)
  • TheSEED:  
    FIG145533: Methyltransferase (EC 2.1.1.-) 
  • PFAM:
    NADP_Rossmann (CL0063) Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 57.2)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 53.3)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 46.2)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 44)
    NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 42.9)
    Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 36)
    Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 28.9)
    MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 28.3)
    PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 21.4)
    MTS; Methyltransferase small domain (PF05175; HMM-score: 20.6)
    RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 18.4)
    CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 17.1)
    Methyltransf_32; Methyltransferase domain (PF13679; HMM-score: 17)
    HEXAPEP (CL0536) Fucokinase; L-fucokinase (PF07959; HMM-score: 14.4)
    NADP_Rossmann (CL0063) FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 14.3)
    PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 13.7)
    Methyltransf_8; Hypothetical methyltransferase (PF05148; HMM-score: 13.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.124
    • Ymax_pos: 28
    • Cmax: 0.117
    • Cmax_pos: 23
    • Smax: 0.213
    • Smax_pos: 19
    • Smean: 0.098
    • D: 0.114
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSQYAEMSLVYDQLTQDQPYEKWFEIVKNHCKDESNILDIGCGTGSLTVQLEALGNVTGMDLSVDMLTVAAQKSANVNWLEGDMTSFDLQQQFDIITIFCDSLNYLQDETAVIETFINVYHHLTDSGVFIFDVHTVYKMMTLFNNQSYIDDKGDIFLAWDAVQGDLPLSVYHDMTFFIRHEDETYSRFDESHFQRTFDEKTYLSWLAQVGFKHVETFTDFNIDEHNEDAERLFFIAKK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 8.75 h [3]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]