From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004177000
  • symbol?:
  • description?: SAM-dependent methyltransferase

      descriptions from strain specific annotations:

    • SAM-dependent methyltransferase
    • Methyltransferase
    • methyltransferase domain protein
    • pseudogene
    • putative methyltransferase
    • type 12 methyltransferase
    • Ubiquinone/menaquinone biosynthesis methyltransferase UbiE/ COQ5
  • strand?: -
  • coordinates?: 4441351..4442068
  • synteny block?: BlockID0032070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1549 (ubiE)
    08BA02176:
    C248_1633
    11819-97:
    MS7_1608
    71193:
    ST398NM01_1656
    ECT-R 2:
    ECTR2_1440
    ED133:
    SAOV_1590
    ED98:
    SAAV_1582
    HO 5096 0412:
    SAEMRSA15_15100
    JH1:
    SaurJH1_1683
    JH9:
    SaurJH9_1648
    JKD6008:
    SAA6008_01561
    JKD6159:
    SAA6159_01526
    LGA251:
    SARLGA251_14960
    M013:
    M013TW_1605
    MRSA252:
    SAR1668
    MSHR1132:
    SAMSHR1132_14300
    MSSA476:
    SAS1528
    Mu3:
    SAHV_1578
    Mu50:
    SAV1591
    MW2:
    MW1542
    RF122:
    SAB1463c
    ST398:
    SAPIG1656
    T0131:
    SAT0131_01686
    TCH60:
    HMPREF0772_11550
    TW20:
    SATW20_15860
    USA300_TCH1516:
    USA300HOU_1592
    VC40:
    SAVC_07210

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQYAEMSLVYDQLTQDQPYEKWFEIVKNHCKDESNILDIGCGTGSLTVQLEALGNVTGM
    N315            MSQYAEMSLVYDQLTQDQPYEKWFEIVKNHCKDESNILDIGCGTGSLTVQLEALGNVTGM
    NCTC8325        MSQYAEMSLVYDQLTQDQPYEKWFEIVKNHCKDESNILDIGCGTGSLTVQLEALGNVTGM
    Newman          MSQYAEMSLVYDQLTQDQPYEKWFEIVKNHCKDESNILDIGCGTGSLTVQLEALGNVTGM
    USA300_FPR3757  MSQYAEMSLVYDQLTQDQPYEKWFEIVKNHCKDESNILDIGCGTGSLTVQLEALGNVTGM
                    ************************************************************

    COL             DLSVDMLTVAAQKSANVNWLEGDMTSFDLQQQFDIITIFCDSLNYLQDETAVIETFINVY
    N315            DLSVDMLTVAAQKSANVNWLEGDMTSFDLQQQFDIITIFCDSLNYLQDETAVIETFINVY
    NCTC8325        DLSVDMLTVAAQKSANVNWLEGDMTSFDLQQQFDIITIFCDSLNYLQDETAVIETFINVY
    Newman          DLSVDMLTVAAQKSANVNWLEGDMTSFDLQQQFDIITIFCDSLNYLQDETAVIETFINVY
    USA300_FPR3757  DLSVDMLTVAAQKSANVNWLEGDMTSFDLQQQFDIITIFCDSLNYLQDETAVIETFINVY
                    ************************************************************

    COL             HHLTDSGVFIFDVHTVYKMMTLFNNQSYIDDKGDIFLAWDAVQGDLPLSVYHDMTFFIRH
    N315            HHLTDSGVFIFDVHTVYKMMTLFNNQSYIDDKGDIFLAWDAVQGDLPLSVYHDMTFFIRH
    NCTC8325        HHLTDSGVFIFDVHTVYKMMTLFNNQSYIDDKGDIFLAWDAVQGDLPLSVYHDMTFFIRH
    Newman          HHLTDSGVFIFDVHTVYKMMTLFNNQSYIDDKGDIFLAWDAVQGDLPLSVYHDMTFFIRH
    USA300_FPR3757  HHLTDSGVFIFDVHTVYKMMTLFNNQSYIDDKGDIFLAWDAVQGDLPLSVYHDMTFFIRH
                    ************************************************************

    COL             EDETYSRFDESHFQRTFDEKTYLSWLAQVGFKHVETFTDFNIDEHNEDAERLFFIAKK
    N315            EDETYSRFDESHFQRTFDEKTYLSWLAQVGFKHVETFTDFNIDEHNEDTERLFFIAKK
    NCTC8325        EDETYSRFDESHFQRTFDEKTYLSWLAQVGFKHVETFTDFNIDEHNEDAERLFFIAKK
    Newman          EDETYSRFDESHFQRTFDEKTYLSWLAQVGFKHVETFTDFNIDEHNEDAERLFFIAKK
    USA300_FPR3757  EDETYSRFDESHFQRTFDEKTYLSWLAQVGFKHVETFTDFNIDEHNEDAERLFFIAKK
                    ************************************************:*********