From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1693 [new locus tag: SACOL_RS08635 ]
  • pan locus tag?: SAUPAN004244000
  • symbol: yajC
  • pan gene symbol?: yajC
  • synonym:
  • product: preprotein translocase, YajC subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1693 [new locus tag: SACOL_RS08635 ]
  • symbol: yajC
  • product: preprotein translocase, YajC subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 1726296..1726556
  • length: 261
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGCAATTTTCATTACTAATATATATAGTCGTAATTTTTGCGGTTATGTATTTCTTGATG
    ATCAGACCACAACAAAAACGTGCGAAACAGCATCGTGAGTTGATTAATAACATTCAATCT
    GGTCAAAGAATTACAACTATTGGTGGTATTAAAGGTACTGTTAAAGCAGTAGATGAAACA
    ACTGTTGTTATTACAGTTAATGGTCATGGTACTGAATTAACTTTCGAAAAACCTGCTATT
    AAACAAGTTGACCCTTCATAA
    60
    120
    180
    240
    261

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1693 [new locus tag: SACOL_RS08635 ]
  • symbol: YajC
  • description: preprotein translocase, YajC subunit
  • length: 86
  • theoretical pI: 10.3856
  • theoretical MW: 9671.32
  • GRAVY: 0.102326

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingpreprotein translocase, YajC subunit (TIGR00739; HMM-score: 91.3)
  • TheSEED:  
    Preprotein translocase subunit YajC (TC 3.A.5.1.1) 
  • PFAM:
    no clan definedYajC; Preprotein translocase subunit (PF02699; HMM-score: 99.1)
    OB (CL0021) RuvA_N; RuvA N terminal domain (PF01330; HMM-score: 19.6)
    no clan definedDUF150_C; RimP C-terminal SH3 domain (PF17384; HMM-score: 17.9)
    Orf78; Orf78 (ac78) (PF06024; HMM-score: 14.8)
    FixQ; Cbb3-type cytochrome oxidase component FixQ (PF05545; HMM-score: 13)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.266
    • Ymax_pos: 29
    • Cmax: 0.244
    • Cmax_pos: 29
    • Smax: 0.51
    • Smax_pos: 26
    • Smean: 0.213
    • D: 0.246
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDETTVVITVNGHGTELTFEKPAIKQVDPS

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]