From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004244000
  • symbol?: yajC
  • description?: preprotein translocase, YajC subunit

      descriptions from strain specific annotations:

    • preprotein translocase, YajC subunit
    • preprotein translocase subunit YajC
    • type I general secretory pathway preprotein translocase subunit YajC
    • exported protein
    • Sec family Type I general secretory pathway preprotein translocase subunit YajC
    • Protein translocase subunit yajC
  • strand?: -
  • coordinates?: 4492462..4492665
  • synteny block?: BlockID0032720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1693 (yajC)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1596 (yajC)
    08BA02176:
    C248_1681
    11819-97:
    MS7_1653 (yajC)
    71193:
    ST398NM01_1701
    ECT-R 2:
    ECTR2_1486 (yajC)
    ED133:
    SAOV_1635
    ED98:
    SAAV_1631 (yajC)
    HO 5096 0412:
    SAEMRSA15_15550
    JH1:
    SaurJH1_1728
    JH9:
    SaurJH9_1695
    JKD6008:
    SAA6008_01607 (yajC)
    JKD6159:
    SAA6159_01570 (yajC)
    LGA251:
    SARLGA251_15400
    M013:
    M013TW_1658
    MRSA252:
    SAR1718
    MSHR1132:
    SAMSHR1132_14740
    MSSA476:
    SAS1574
    Mu3:
    SAHV_1625
    Mu50:
    SAV1638
    MW2:
    MW1588
    RF122:
    SAB1507c
    ST398:
    SAPIG1701 (yajC)
    T0131:
    SAT0131_01738 (nagB)
    TCH60:
    HMPREF0772_11504 (yajC)
    TW20:
    SATW20_16320
    USA300_TCH1516:
    USA300HOU_1637 (yajC)
    VC40:
    SAVC_07435

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDET
    N315            MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDET
    NCTC8325        MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDET
    Newman          MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDET
    USA300_FPR3757  MQFSLLIYIVVIFAVMYFLMIRPQQKRAKQHRELINNIQSGQRITTIGGIKGTVKAVDET
                    ************************************************************

    COL             TVVITVNGHGTELTFEKPAIKQVDPS
    N315            TVVITVNGHGTELTFEKPAIKQVDPS
    NCTC8325        TVVITVNGHGTELTFEKPAIKQVDPS
    Newman          TVVITVNGHGTELTFEKPAIKQVDPS
    USA300_FPR3757  TVVITVNGHGTELTFEKPAIKQVDPS
                    **************************