From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1711 [new locus tag: SACOL_RS08740 ]
  • pan locus tag?: SAUPAN004277000
  • symbol: SACOL1711
  • pan gene symbol?: tag
  • synonym:
  • product: DNA-3-methyladenine glycosylase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1711 [new locus tag: SACOL_RS08740 ]
  • symbol: SACOL1711
  • product: DNA-3-methyladenine glycosylase
  • replicon: chromosome
  • strand: +
  • coordinates: 1742669..1743229
  • length: 561
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATGAATGCGCATTTGGTACTAAAGATCCAGTCTACTTAGACTATCATGATCATGTA
    TGGGGACAACCGCTCTATGATAGCAAGGCATTGTTTAAACTTTTAGCATTAGAATCACAA
    CATGCTGGGCTATCTTGGTTAACTATTTTAAAAAAGAAAGAAGCCTCTGAAGAAGCATTT
    TATGATTTCGAACCAGAAAAGGTAGCACAAATGACCGCTCAAGATATCGACCGCTTAATG
    ACTTTTCCAAATATCGTTCATCATCGTAAAAAATTAGAAGCAATTGTTAATCAAGCTCAA
    GGGTATTTAAAAATTGAACAAGCATATGGTAGTTTTAGTAAATTTTTATGGTCATATGTA
    AATGGTAAGCCTAAAGATTTGCAGTATGAACATGCTTCTGATCGTATCACAGTTGATGAT
    ACTGCAACACAACTATCTAAAGATTTAAAACAATACGGGTTTAAATTTTTAGGTCCAGTA
    ACAGTATTTTCGTTTTTAGAAGCAGCCGGTTTATATGATGCACATTTACAAGATTGTCCA
    TCAAAGCCTAAACATAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    561

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1711 [new locus tag: SACOL_RS08740 ]
  • symbol: SACOL1711
  • description: DNA-3-methyladenine glycosylase
  • length: 186
  • theoretical pI: 6.51001
  • theoretical MW: 21340
  • GRAVY: -0.474194

Function[edit source | edit]

  • reaction:
    EC 3.2.2.-?  ExPASy
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA-3-methyladenine glycosylase I (TIGR00624; EC 3.2.2.20; HMM-score: 186.1)
  • TheSEED:  
    DNA MetabolismDNA repairDNA Repair Base Excision DNA-3-methyladenine glycosylase (EC 3.2.2.20) 
  • PFAM:
    no clan definedAdenine_glyco; Methyladenine glycosylase (PF03352; HMM-score: 210.5)
    DUF3326; Protein of unknown function (DUF3326) (PF11805; HMM-score: 11)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.126
    • Ymax_pos: 56
    • Cmax: 0.127
    • Cmax_pos: 56
    • Smax: 0.203
    • Smax_pos: 41
    • Smean: 0.08
    • D: 0.108
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNECAFGTKDPVYLDYHDHVWGQPLYDSKALFKLLALESQHAGLSWLTILKKKEASEEAFYDFEPEKVAQMTAQDIDRLMTFPNIVHHRKKLEAIVNQAQGYLKIEQAYGSFSKFLWSYVNGKPKDLQYEHASDRITVDDTATQLSKDLKQYGFKFLGPVTVFSFLEAAGLYDAHLQDCPSKPKHN

Experimental data[edit source | edit]

  • experimental localization: Cytoplasmic [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL1711 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]