From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1771 [new locus tag: SACOL_RS09060 ]
  • pan locus tag?: SAUPAN004376000
  • symbol: SACOL1771
  • pan gene symbol?:
  • synonym:
  • product: OsmC/Ohr family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1771 [new locus tag: SACOL_RS09060 ]
  • symbol: SACOL1771
  • product: OsmC/Ohr family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1810177..1810623
  • length: 447
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGCATCAACATGACTTTAAAGTCCAAACTTCTTGGCAAGGTGGTCGTAACAATGTCGGA
    AACGTTCAAGGCGACATACTTTCAGAGAATATTTCTATACCTGCTTCTTTAGGTGGTGTT
    GGTATAGGAACAAATCCCGATGAAATGTTAGTATCAGCCGCTTCATCATGTTATATCATC
    TCATTAGCAGCTACTCTTGAACGTGCAAAGTTCACAGATATTTCAATTGAACAACAATCG
    ATTGGAACAGCTTGTTTAAATAACGGAAAATTCAGTATGTCAAAAATTGTGCACCATCCT
    CAAATTCAAATTCCAAGTGATCAAATAGCACAATTAGAAAAGCGATTACCAAAATTGATA
    ACAATTGCAGATAATAATTGCATGATTTCAAATGCTGTAAGAAATAATGTGGACATAAAA
    ATCTATCCCATCATTCAGGCCAAATAA
    60
    120
    180
    240
    300
    360
    420
    447

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1771 [new locus tag: SACOL_RS09060 ]
  • symbol: SACOL1771
  • description: OsmC/Ohr family protein
  • length: 148
  • theoretical pI: 7.50798
  • theoretical MW: 16070.3
  • GRAVY: -0.107432

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    peroxiredoxin, SACOL1771 subfamily (TIGR03563; HMM-score: 203.3)
    Cellular processesCellular processesDetoxificationperoxiredoxin, Ohr subfamily (TIGR03561; HMM-score: 47.6)
    Cellular processesCellular processesDetoxificationperoxiredoxin, OsmC subfamily (TIGR03562; HMM-score: 37.1)
  • TheSEED:  
    Stress ResponseOxidative stressOxidative stress Organic hydroperoxide resistance protein 
    CBSS-269482.1.peg.1294 Organic hydroperoxide resistance protein 
  • PFAM:
    no clan definedOsmC; OsmC-like protein (PF02566; HMM-score: 72.2)
    MadL; Malonate transporter MadL subunit (PF03817; HMM-score: 13)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.121
    • Ymax_pos: 43
    • Cmax: 0.15
    • Cmax_pos: 64
    • Smax: 0.178
    • Smax_pos: 2
    • Smean: 0.11
    • D: 0.117
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MHQHDFKVQTSWQGGRNNVGNVQGDILSENISIPASLGGVGIGTNPDEMLVSAASSCYIISLAATLERAKFTDISIEQQSIGTACLNNGKFSMSKIVHHPQIQIPSDQIAQLEKRLPKLITIADNNCMISNAVRNNVDIKIYPIIQAK

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2]
    quantitative data / protein copy number per cell: 75 [3]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]