From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004376000
  • symbol?:
  • description?: OsmC family protein

      descriptions from strain specific annotations:

    • OsmC family protein
    • OsmC/Ohr family protein
    • Organic hydroperoxide resistance protein
    • osmC-like family protein
    • OsmC-like protein
    • osmotic stress-related protein
    • OsmotiCALL import_20_25_26_pangenomey inducible protein C
    • Osmotic stress regulator
    • peroxiredoxin family protein
  • strand?: +
  • coordinates?: 4615393..4615893
  • synteny block?: BlockID0033810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1680
    08BA02176:
    C248_1762
    11819-97:
    MS7_1728
    71193:
    ST398NM01_1774
    ECT-R 2:
    ECTR2_1562
    ED133:
    SAOV_1708
    ED98:
    SAAV_1732
    HO 5096 0412:
    SAEMRSA15_16300
    JH1:
    SaurJH1_1812
    JH9:
    SaurJH9_1777
    JKD6008:
    SAA6008_01690 (ohr)
    JKD6159:
    SAA6159_01645 (ohr)
    LGA251:
    SARLGA251_16120
    M013:
    M013TW_1734
    MRSA252:
    SAR1799
    MSHR1132:
    SAMSHR1132_15710
    MSSA476:
    SAS1648
    Mu3:
    SAHV_1708
    Mu50:
    SAV1722
    MW2:
    MW1664
    RF122:
    SAB1580
    ST398:
    SAPIG1774
    T0131:
    SAT0131_01825
    TCH60:
    HMPREF0772_11431
    TW20:
    SATW20_17120
    USA300_TCH1516:
    USA300HOU_1710
    VC40:
    SAVC_07815

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHQHDFKVQTSWQGGRNNVGNVQGDILSENISIPASLGGVGIGTNPDEMLVSAASSCYII
    N315            MHQHDFKVQTSWQGGRNNVGNVQGDILSENISIPASLGGVGIGTNPDEMLVSAASSCYII
    NCTC8325        MHQHDFKVQTSWQGGRNNVGNVQGDILSENISIPASLGGVGIGTNPDEMLVSAASSCYII
    Newman          MHQHDFKVQTSWQGGRNNVGNVQGDILSENISIPASLGGVGIGTNPDEMLVSAASSCYII
    USA300_FPR3757  MHQHDFKVQTSWQGGRNNVGNVQGDILSENISIPASLGGVGIGTNPDEMLVSAASSCYII
                    ************************************************************

    COL             SLAATLERAKFTDISIEQQSIGTACLNNGKFSMSKIVHHPQIQIPSDQIAQLEKRLPKLI
    N315            SLAATLERAKFTDISIEQQSIGTACLNNGKFSMSKIVHHPHIEIPSDQIAQLEKRLPKLI
    NCTC8325        SLAATLERAKFTDISIEQQSIGTACLNNGKFSMSKIVHHPQIQIPSDQIAQLEKRLPKLI
    Newman          SLAATLERAKFTDISIEQQSIGTACLNNGKFSMSKIVHHPQIQIPSDQIAQLEKRLPKLI
    USA300_FPR3757  SLAATLERAKFTDISIEQQSIGTACLNNGKFSMSKIVHHPQIQIPSDQIAQLEKRLPKLI
                    ****************************************:*:*****************

    COL             TIADNNCMISNAVRNNVDIKIYPIIQAK
    N315            TIADNNCMISNAVRNNVDIKIYPIIQAK
    NCTC8325        TIADNNCMISNAVRNNVDIKIYPIIQAK
    Newman          TIADNNCMISNAVRNNVDIKIYPIIQAK
    USA300_FPR3757  TIADNNCMISNAVRNNVDIKIYPIIQAK
                    ****************************