From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1798 [new locus tag: SACOL_RS09215 ]
  • pan locus tag?: SAUPAN004425000
  • symbol: trmB
  • pan gene symbol?: trmB
  • synonym:
  • product: tRNA (guanine-N(7)-)-methyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1798 [new locus tag: SACOL_RS09215 ]
  • symbol: trmB
  • product: tRNA (guanine-N(7)-)-methyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1845832..1846476
  • length: 645
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAGAGTTCGATACAAACCATGGGCTAAAGATTATTTAAAAGATCATCCTGAATTGGTT
    GACATGGACGGTCAACATGCAGGGAAAATGACTGAATGGTTTGATAAAACGCAACCGATA
    CACATTGAAATTGGTTCGGGTATGGGGCAGTTTATTACAACATTAGCTGCTCAAAATCCT
    CATATTAACTATATTTCAATGGAACGTGAGAAAAGTATCGTTTATAAAGTATTGGATAAA
    GTTAAAGAGATGGGTTTAACAAATTTAAAGATTATTTGTAATGACGCCATTGAATTAAAT
    GAATATTTTAAAGACGGCGAAGTTTCGCGTATTTATTTGAACTTTTCAGATCCATGGCCA
    AAAAATCGTCATGCAAAACGACGTTTAACGTATCATACGTTTTTAGCGTTGTATCAACAA
    ATCTTAAATGATGAAGGAGATTTACATTTTAAAACTGATAACAGAGGACTATTTGCCTAC
    AGTTTAGAAAGTATGTCTCAATTTGGAATGTATTTTACAAAAATAAATCTAAATTTACAT
    CAAGAAGACGATGGCAGTAATATTTTAACAGAATATGAAAAGAAATTTTCGGATAAAGGG
    TCACGTATTTATCGTATGGAAGCGAAATTCCATTCACAAAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    645

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1798 [new locus tag: SACOL_RS09215 ]
  • symbol: TrmB
  • description: tRNA (guanine-N(7)-)-methyltransferase
  • length: 214
  • theoretical pI: 7.82983
  • theoretical MW: 25274.6
  • GRAVY: -0.709813

Function[edit source | edit]

  • reaction:
    EC 2.1.1.33?  ExPASy
    tRNA (guanine46-N7)-methyltransferaseS-adenosyl-L-methionine + guanine46 in tRNA = S-adenosyl-L-homocysteine + N7-methylguanine46 in tRNA
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 184.4)
    Genetic information processingProtein synthesistRNA and rRNA base modificationribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 16.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotinmalonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 14.9)
    Genetic information processingProtein fateProtein modification and repairprotein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 13.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminprecorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 13.2)
  • TheSEED:  
    tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33) 
  • PFAM:
    NADP_Rossmann (CL0063) Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 169.6)
    DUF938; Protein of unknown function (DUF938) (PF06080; HMM-score: 17.9)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 16.2)
    PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 15.4)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 15.2)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 13.3)
    Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 12.2)
    GidB; rRNA small subunit methyltransferase G (PF02527; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.101
    • Ymax_pos: 58
    • Cmax: 0.118
    • Cmax_pos: 57
    • Smax: 0.154
    • Smax_pos: 3
    • Smean: 0.077
    • D: 0.091
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRVRYKPWAKDYLKDHPELVDMDGQHAGKMTEWFDKTQPIHIEIGSGMGQFITTLAAQNPHINYISMEREKSIVYKVLDKVKEMGLTNLKIICNDAIELNEYFKDGEVSRIYLNFSDPWPKNRHAKRRLTYHTFLALYQQILNDEGDLHFKTDNRGLFAYSLESMSQFGMYFTKINLNLHQEDDGSNILTEYEKKFSDKGSRIYRMEAKFHSQK

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2]
    quantitative data / protein copy number per cell: 62 [3]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 10.99 h [4]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  4. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]

H De Lencastre, S W Wu, M G Pinho, A M Ludovice, S Filipe, S Gardete, R Sobral, S Gill, M Chung, A Tomasz
Antibiotic resistance as a stress response: complete sequencing of a large number of chromosomal loci in Staphylococcus aureus strain COL that impact on the expression of resistance to methicillin.
Microb. Drug Resist.: 1999, 5(3);163-75
[PubMed:10566865] [WorldCat.org] (P p)