From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1954 [new locus tag: SACOL_RS10220 ]
  • pan locus tag?: SAUPAN004918000
  • symbol: SACOL1954
  • pan gene symbol?:
  • synonym:
  • product: exonuclease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1954 [new locus tag: SACOL_RS10220 ]
  • symbol: SACOL1954
  • product: exonuclease
  • replicon: chromosome
  • strand: +
  • coordinates: 2014487..2015041
  • length: 555
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATACAAGATGCGTTTGTTGCACTTGATTTTGAAACAGCAAATGGTAAACGTACAAGT
    ATTTGTTCTGTCGGAATGGTTAAAGTCATTGATAGTCAAATAACAGAAACATTTCATACT
    CTTGTGAATCCGCAAGACTATTTTTCACAACAAAATATTAAAATTCATGGCATACAACCA
    GAAGATGTTGAAAATGCACCTACGTTTGACTACGTATTTCCATATATGATGCAATTTATT
    GCAGATTTACCTGTTGTCGCACATAACGCGGCATTTGATATGAACGTCTTACATCAAAGC
    ATTCAAAATATTGGTTTACCAACTCCAAATTTAACTTACTTTTGTAGTTATCAACTTGCT
    AAAAGAACCGTTGATTCGTATCGATACGGTTTAAAACATATGATGGAGTTTTATCAATTA
    GATTTTCATGGTCATCATGATGCATTGAATGATGCCAAAGCATGCGCAATGATTACTTTT
    AGGCTACTGAAAAATTATGAAAATTTAACATATGTAACTAATATTTATGGTAAAAATCTA
    AAAGATAAAGGCTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    555

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1954 [new locus tag: SACOL_RS10220 ]
  • symbol: SACOL1954
  • description: exonuclease
  • length: 184
  • theoretical pI: 6.2936
  • theoretical MW: 21120
  • GRAVY: -0.209239

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, alpha subunit, Gram-positive type (TIGR01405; EC 2.7.7.7; HMM-score: 87.1)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairputative DnaQ family exonuclease/DinG family helicase (TIGR01407; HMM-score: 81.4)
    Genetic information processingDNA metabolismDegradation of DNAexonuclease, DNA polymerase III, epsilon subunit family (TIGR00573; EC 2.7.7.7; HMM-score: 69.7)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, epsilon subunit (TIGR01406; EC 2.7.7.7; HMM-score: 67.5)
    Genetic information processingTranscriptionRNA processingribonuclease T (TIGR01298; EC 3.1.13.-; HMM-score: 12.6)
  • TheSEED:  
    DNA-replication DNA polymerase III polC-type (EC 2.7.7.7) 
  • PFAM:
    RNase_H (CL0219) RNase_T; Exonuclease (PF00929; HMM-score: 87.9)
    DUF5051; 3' exoribonuclease, RNase T-like (PF16473; HMM-score: 51.1)
    DNA_pol_A_exo1; 3'-5' exonuclease (PF01612; HMM-score: 20.6)
    no clan definedDUF1265; Protein of unknown function (DUF1265) (PF06887; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.175
    • Ymax_pos: 41
    • Cmax: 0.127
    • Cmax_pos: 50
    • Smax: 0.395
    • Smax_pos: 31
    • Smean: 0.171
    • D: 0.174
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIQDAFVALDFETANGKRTSICSVGMVKVIDSQITETFHTLVNPQDYFSQQNIKIHGIQPEDVENAPTFDYVFPYMMQFIADLPVVAHNAAFDMNVLHQSIQNIGLPTPNLTYFCSYQLAKRTVDSYRYGLKHMMEFYQLDFHGHHDALNDAKACAMITFRLLKNYENLTYVTNIYGKNLKDKG

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL1954 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]