From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004918000
  • symbol?:
  • description?: DNA polymerase III subunit epsilon

      descriptions from strain specific annotations:

    • DNA polymerase III subunit epsilon
    • exonuclease
    • exonuclease, RNase T and DNA polymerase III
    • DNA-directed DNA polymerase III
    • DNA polymerase III alpha chain
    • DNA polymerase III polC-type
    • DNA polymerase III subunit alpha PolC-type
    • exonuclease family protein
    • exonuclease RNase T and DNA polymerase III
    • putative exonuclease
  • strand?: +
  • coordinates?: 5107301..5107855
  • synteny block?: BlockID0038240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1850 (polC)
    08BA02176:
    C248_1968
    11819-97:
    MS7_1929
    71193:
    ST398NM01_1987
    ECT-R 2:
    ECTR2_1765
    ED133:
    SAOV_1993
    ED98:
    SAAV_1960
    HO 5096 0412:
    SAEMRSA15_18010
    JH1:
    SaurJH1_1982
    JH9:
    SaurJH9_1948
    JKD6008:
    SAA6008_01914
    JKD6159:
    SAA6159_01825
    LGA251:
    SARLGA251_17760
    M013:
    M013TW_1930
    MRSA252:
    SAR1985
    MSHR1132:
    SAMSHR1132_17390
    MSSA476:
    SAS1816
    Mu3:
    SAHV_1879
    Mu50:
    SAV1894
    MW2:
    MW1835
    RF122:
    SAB1826
    ST398:
    SAPIG1987
    T0131:
    SAT0131_02019
    TCH60:
    HMPREF0772_11249
    TW20:
    SATW20_18880
    USA300_TCH1516:
    USA300HOU_1893
    VC40:
    SAVC_08730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIQDAFVALDFETANGKRTSICSVGMVKVIDSQITETFHTLVNPQDYFSQQNIKIHGIQP
    N315            MIQDAFVALDFETANGKRTSICSVGMVKVIDSQITETFHTLVNPQDYFSQQNIKVHGIQP
    NCTC8325        MIQDAFVALDFETANGKRTSICSVGMVKVIDSQITETFHTLVNPQDYFSQQNIKIHGIQP
    Newman          MIQDAFVALDFETANGKRTSICSVGMVKVIDSQITETFHTLVNPQDYFSQQNIKIHGIQP
    USA300_FPR3757  MIQDAFVALDFETANGKRTSICSVGMVKVIDSQITETFHTLVNPQDYFSQQNIKIHGIQP
                    ******************************************************:*****

    COL             EDVENAPTFDYVFPYMMQFIADLPVVAHNAAFDMNVLHQSIQNIGLPTPNLTYFCSYQLA
    N315            EDVENAPTFDYVFPYMMQFIADLPVVAHNAAFDMNVLHQSIQNIGLPTPNLTYFCSYQLA
    NCTC8325        EDVENAPTFDYVFPYMMQFIADLPVVAHNAAFDMNVLHQSIQNIGLPTPNLTYFCSYQLA
    Newman          EDVENAPTFDYVFPYMMQFIADLPVVAHNAAFDMNVLHQSIQNIGLPTPNLTYFCSYQLA
    USA300_FPR3757  EDVENAPTFDYVFPYMMQFIADLPVVAHNAAFDMNVLHQSIQNIGLPTPNLTYFCSYQLA
                    ************************************************************

    COL             KRTVDSYRYGLKHMMEFYQLDFHGHHDALNDAKACAMITFRLLKNYENLTYVTNIYGKNL
    N315            KRTVDSYRYGLKHMMEFYQLDFHGHHDALNDAKACAMITFRLLKNYENLTYVTNIYGKNL
    NCTC8325        KRTVDSYRYGLKHMMEFYQLDFHGHHDALNDAKACAMITFRLLKNYENLTYVTNIYGKNL
    Newman          KRTVDSYRYGLKHMMEFYQLDFHGHHDALNDAKACAMITFRLLKNYENLTYVTNIYGKNL
    USA300_FPR3757  KRTVDSYRYGLKHMMEFYQLDFHGHHDALNDAKACAMITFRLLKNYENLTYVTNIYGKNL
                    ************************************************************

    COL             KDKG
    N315            KDKG
    NCTC8325        KDKG
    Newman          KDKG
    USA300_FPR3757  KDKG
                    ****