From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2039 [new locus tag: SACOL_RS10645 ]
  • pan locus tag?: SAUPAN005299000
  • symbol: SACOL2039
  • pan gene symbol?: rimI
  • synonym:
  • product: ribosomal-protein-alanine acetyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2039 [new locus tag: SACOL_RS10645 ]
  • symbol: SACOL2039
  • product: ribosomal-protein-alanine acetyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2099017..2099481
  • length: 465
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGGATCAACAGTCAAAAGAACAATTAAACATTAGAGAGATGACTAAAGAAGATGTGCCA
    CAAGTCTTTGATCTTGAGCGTCGGAGTTTCAATGACAGTTCTTGGACAATTGACGCATTT
    TATCATGAAATAGAGCAAAATAACTTTGCGAAATATTTTGTCTTAGAATTTGAACAACAA
    ATTATTGGTTATTTAGGTTTATGGATTGTTATCGATCAAGCTCAAATTACAACAGTTGCA
    ATCGATGATAATTATAGAGGCTATGGTTTAGGTCAAATGCTTTTAAAATACGGAATAAAC
    TATGCAAGTCACACTTGTGATGTGATGAGTTTAGAAGTAAGAGTTAATAATAAAGTGGCA
    CAACATGTATATGAAAATTTAGGATTTCAATATGGTGGTAAACGTAAAAATTATTATGGT
    GAAGGTGAGGACGCAATGGTTATGTGGGTGAATTTAAATGACTAA
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2039 [new locus tag: SACOL_RS10645 ]
  • symbol: SACOL2039
  • description: ribosomal-protein-alanine acetyltransferase
  • length: 154
  • theoretical pI: 4.37874
  • theoretical MW: 18076.1
  • GRAVY: -0.496104

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 117.7)
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (TIGR03585; EC 2.3.1.202; HMM-score: 32.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsmycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 30.3)
    MetabolismAmino acid biosynthesisGlutamate familyamino-acid N-acetyltransferase (TIGR01890; EC 2.3.1.1; HMM-score: 17.1)
    putative beta-lysine N-acetyltransferase (TIGR03827; EC 2.3.1.-; HMM-score: 16.4)
    GNAT-family acetyltransferase TIGR03103 (TIGR03103; HMM-score: 15.9)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisRibosome biogenesis bacterial Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-) 
    RNA MetabolismRNA processing and modificationYrdC-YciO-Sua5 and associated protein families Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-) 
    Bacterial RNA-metabolizing Zn-dependent hydrolases Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-) 
    Conserved gene cluster associated with Met-tRNA formyltransferase Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-) 
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 59.6)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 49.5)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 48.1)
    Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 28.5)
    Acetyltransf_3; Acetyltransferase (GNAT) domain (PF13302; HMM-score: 26.3)
    Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 26)
    FR47; FR47-like protein (PF08445; HMM-score: 25.5)
    Acetyltransf_8; Acetyltransferase (GNAT) domain (PF13523; HMM-score: 14)
    Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.097
    • Ymax_pos: 11
    • Cmax: 0.103
    • Cmax_pos: 53
    • Smax: 0.138
    • Smax_pos: 2
    • Smean: 0.094
    • D: 0.096
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDQQSKEQLNIREMTKEDVPQVFDLERRSFNDSSWTIDAFYHEIEQNNFAKYFVLEFEQQIIGYLGLWIVIDQAQITTVAIDDNYRGYGLGQMLLKYGINYASHTCDVMSLEVRVNNKVAQHVYENLGFQYGGKRKNYYGEGEDAMVMWVNLND

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]