From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2093 [new locus tag: SACOL_RS10950 ]
  • pan locus tag?: SAUPAN005389000
  • symbol: SACOL2093
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2093 [new locus tag: SACOL_RS10950 ]
  • symbol: SACOL2093
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2155920..2156153
  • length: 234
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGGATTATATCGGACAATATGCAGTTATCCATTTAGTGTTACATGTTGTATGTATTTGT
    ATTGCCTATTGGGCTTTACAATCAATTAGATTAGATCAATTTTTTAAAAAAGGATACGCC
    ACTCAATTACAAGTGTGTATGATATTTGTTGCTATTTTATTAGGCACTGCAGTAAGCAAT
    TTTATTGTAGATTTGTTACAATACTCGACGCAGGTAAAATATTTAATAAAATAA
    60
    120
    180
    234

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2093 [new locus tag: SACOL_RS10950 ]
  • symbol: SACOL2093
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 8.46673
  • theoretical MW: 8847.59
  • GRAVY: 0.911688

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    conserved hypothetical integral membrane protein (TIGR02327; HMM-score: 61.1)
  • TheSEED:  
    Uncharacterized membrane protein YwzB 
  • PFAM:
    no clan definedDUF1146; Protein of unknown function (DUF1146) (PF06612; HMM-score: 72.3)
    APC (CL0062) CstA; Carbon starvation protein CstA (PF02554; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 34
    • Cmax: 0.116
    • Cmax_pos: 25
    • Smax: 0.166
    • Smax_pos: 24
    • Smean: 0.094
    • D: 0.107
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDYIGQYAVIHLVLHVVCICIAYWALQSIRLDQFFKKGYATQLQVCMIFVAILLGTAVSNFIVDLLQYSTQVKYLIK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [1] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]