From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005389000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Integral membrane protein
    • membrane associated protein
  • strand?: -
  • coordinates?: 5554137..5554370
  • synteny block?: BlockID0041850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2041
    08BA02176:
    C248_2115
    11819-97:
    MS7_2117
    71193:
    ST398NM01_2143
    ECT-R 2:
    ECTR2_1957
    ED133:
    SAOV_2142c
    ED98:
    SAAV_2156
    HO 5096 0412:
    SAEMRSA15_20090
    JH1:
    SaurJH1_2175
    JH9:
    SaurJH9_2137
    JKD6008:
    SAA6008_02139
    JKD6159:
    SAA6159_02014
    LGA251:
    SARLGA251_19020
    M013:
    M013TW_2060
    MRSA252:
    SAR2189
    MSHR1132:
    SAMSHR1132_19240
    MSSA476:
    SAS2004
    Mu3:
    SAHV_2085
    Mu50:
    SAV2101
    MW2:
    MW2025
    RF122:
    SAB1985c
    ST398:
    SAPIG2143
    T0131:
    SAT0131_02262
    TCH60:
    HMPREF0772_11091
    TW20:
    SATW20_22390
    USA300_TCH1516:
    USA300HOU_2091
    VC40:
    SAVC_09380

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDYIGQYAVIHLVLHVVCICIAYWALQSIRLDQFFKKGYATQLQVCMIFVAILLGTAVSN
    N315            MDYIGQYAVIHLVLHVVCICIAYWALQSIRLDQFFKKGYATQLQVCMIFVAILLGTAVSN
    NCTC8325        MDYIGQYAVIHLVLHVVCICIAYWALQSIRLDQFFKKGYATQLQVCMIFVAILLGTAVSN
    Newman          MDYIGQYAVIHLVLHVVCICIAYWALQSIRLDQFFKKGYATQLQVCMIFVAILLGTAVSN
    USA300_FPR3757  MDYIGQYAVIHLVLHVVCICIAYWALQSIRLDQFFKKGYATQLQVCMIFVAILLGTAVSN
                    ************************************************************

    COL             FIVDLLQYSTQVKYLIK
    N315            FIVDLLQYSTQVKYLIK
    NCTC8325        FIVDLLQYSTQVKYLIK
    Newman          FIVDLLQYSTQVKYLIK
    USA300_FPR3757  FIVDLLQYSTQVKYLIK
                    *****************