From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2137 [new locus tag: SACOL_RS11185 ]
  • pan locus tag?: SAUPAN005443000
  • symbol: czrA
  • pan gene symbol?: czrA
  • synonym:
  • product: transcriptional regulator CzrA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2137 [new locus tag: SACOL_RS11185 ]
  • symbol: czrA
  • product: transcriptional regulator CzrA
  • replicon: chromosome
  • strand: +
  • coordinates: 2198282..2198602
  • length: 321
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGTCAGAACAATATTCAGAAATAAATACAGATACATTAGAACGCGTAACTGAAATTTTC
    AAGGCATTAGGCGATTACAATCGAATACGTATCATGGAATTGTTATCAGTCAGCGAAGCA
    AGTGTTGGTCACATTTCACATCAATTGAATTTATCTCAATCAAATGTCTCGCACCAATTA
    AAATTACTTAAAAGTGTGCATCTTGTGAAAGCAAAACGACAAGGCCAATCAATGATTTAT
    TCATTAGATGACATCCACGTAGCAACTATGTTAAAGCAAGCCATACATCACGCGAATCAT
    CCTAAAGAAAGTGGGTTATAA
    60
    120
    180
    240
    300
    321

Protein[edit source | edit]

Protein Data Bank: 4GGG

General[edit source | edit]

  • locus tag: SACOL2137 [new locus tag: SACOL_RS11185 ]
  • symbol: CzrA
  • description: transcriptional regulator CzrA
  • length: 106
  • theoretical pI: 8.01089
  • theoretical MW: 11988.6
  • GRAVY: -0.336792

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 25.7)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.2)
    MetabolismAmino acid biosynthesisGlutamate familyarginine repressor (TIGR01529; HMM-score: 13.4)
    Signal transductionRegulatory functionsDNA interactionsarginine repressor (TIGR01529; HMM-score: 13.4)
  • TheSEED:  
    Zn(II) or Co(II)-specific transcriptional repressor protein 
  • PFAM:
    HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 40.2)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 35.9)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 19.9)
    Vps51 (CL0295) Sec8_exocyst; Sec8 exocyst complex component specific domain (PF04048; HMM-score: 17.1)
    HTH (CL0123) TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.7)
    no clan definedDUF4423; Domain of unknown function (DUF4423) (PF14394; HMM-score: 15.4)
    HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.7)
    MarR_2; MarR family (PF12802; HMM-score: 13.9)
    TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 13.8)
    HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 13.6)
    HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.136
    • Ymax_pos: 49
    • Cmax: 0.123
    • Cmax_pos: 55
    • Smax: 0.217
    • Smax_pos: 44
    • Smean: 0.096
    • D: 0.12
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSEQYSEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKESGL

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CzrA
    CzrA (TF) important in Zinc resistance  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]