From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005443000
  • symbol?: czrA
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • transcriptional regulator CzrA
    • repressor protein
    • zinc and cobalt transport repressor protein
    • ArsR family transcriptional regulator
    • czrA protein
    • metal transport repressor protein CzrA
    • regulatory protein, arsR family protein
    • transcriptional repressor, arsR family
    • Zn(II) or Co(II)-specific transcriptional repressor protein
  • strand?: +
  • coordinates?: 5601410..5601730
  • synteny block?: BlockID0042380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2137 (czrA)
    N315:
    SA1947 (czrA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2085 (czrA)
    08BA02176:
    C248_2160 (czrA)
    11819-97:
    MS7_2163 (rzcA)
    71193:
    ST398NM01_2187
    ECT-R 2:
    ECTR2_2001
    ED133:
    SAOV_2184
    ED98:
    SAAV_2200 (czrA)
    HO 5096 0412:
    SAEMRSA15_20530 (czrA)
    JH1:
    SaurJH1_2219
    JH9:
    SaurJH9_2181
    JKD6008:
    SAA6008_02184 (czrA)
    JKD6159:
    SAA6159_02059
    LGA251:
    SARLGA251_19460 (czrA)
    M013:
    M013TW_2105
    MRSA252:
    SAR2233 (czrA)
    MSHR1132:
    SAMSHR1132_19680
    MSSA476:
    SAS2048
    Mu3:
    SAHV_2129 (czrA)
    Mu50:
    SAV2145 (czrA)
    MW2:
    MW2069 (czrA)
    RF122:
    SAB2029 (czrA)
    ST398:
    SAPIG2187
    T0131:
    SAT0131_02310
    TCH60:
    HMPREF0772_11045 (czrA)
    TW20:
    SATW20_22830 (czrA)
    USA300_TCH1516:
    USA300HOU_2134 (czrA)
    VC40:
    SAVC_09605

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEQYSEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQL
    N315            MSEQYSEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQL
    NCTC8325        MSEQYSEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQL
    Newman          MSEQYSEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQL
    USA300_FPR3757  MSEQYSEINTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQL
                    ************************************************************

    COL             KLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKESGL
    N315            KLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKESGL
    NCTC8325        KLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKESGL
    Newman          KLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKESGL
    USA300_FPR3757  KLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKESGL
                    **********************************************