From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2175 [new locus tag: SACOL_RS11445 ]
  • pan locus tag?: SAUPAN005580000
  • symbol: SACOL2175
  • pan gene symbol?: amaP
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2175 [new locus tag: SACOL_RS11445 ]
  • symbol: SACOL2175
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2256270..2256818
  • length: 549
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    GTGTCGTTAGGGGTGAAACGACTTAAAAACTTTATCCTTGGCTTATTAATAGTAGTAATC
    GTGGGGTTCCTGTTATTCATGTATATCCAAGATGGACGTATAACTGAATATCAAGACTAC
    TTCCTTCAATTTGAATGGTTCCAACCATTACTTATTTCACTTGCTGCACTATTGATATTA
    ATAGGTCTTATATTAGTATTTAGTATCTTCAAACCTACGCATCGAAAACCTGGATTATAC
    AAAGACTTCGATGATGGTCATGTTTACGTATCTCGTAAAGCTGTTGAAAAGACGGCATTC
    GATACGGTTGCAAAATATGATCAAGTAAGACAACCAAATGTAGTTGCGAAACTATATAAC
    AAAAAAAATAAATCTTATATCGACATTAAAACTGACTTTTTCGTACCAAATAATGTTCAA
    GTTCAATCTTTAACTGAAGCAATTCGTTCGGATATTAAAAAGAATGTAGAATATTTCACA
    GAAATGCCAGTACGTAAGTTAGAAGTTAATGTGAGAGATCAGAAAACTTCTGGTCCACGA
    GTGTTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    549

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2175 [new locus tag: SACOL_RS11445 ]
  • symbol: SACOL2175
  • description: hypothetical protein
  • length: 182
  • theoretical pI: 10.0687
  • theoretical MW: 21156.7
  • GRAVY: 0.0373626

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Hypothetical protein SAV2184 
  • PFAM:
    no clan definedAsp23; Asp23 family, cell envelope-related function (PF03780; HMM-score: 23)
    LysE (CL0292) SfLAP; Sap, sulfolipid-1-addressing protein (PF11139; HMM-score: 15.5)
    TauE; Sulfite exporter TauE/SafE (PF01925; HMM-score: 15)
    BPD_transp_1 (CL0404) FtsX; FtsX-like permease family (PF02687; HMM-score: 14.5)
    no clan definedDUF3098; Protein of unknown function (DUF3098) (PF11297; HMM-score: 14.3)
    COX1; Cytochrome C and Quinol oxidase polypeptide I (PF00115; HMM-score: 13.9)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 13.7)
    no clan definedSpore_III_AF; Stage III sporulation protein AF (Spore_III_AF) (PF09581; HMM-score: 13.3)
    YoqO; YoqO-like protein (PF14037; HMM-score: 12.8)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 12.1)
    TPR (CL0020) Fis1_TPR_C; Fis1 C-terminal tetratricopeptide repeat (PF14853; HMM-score: 12.1)
    no clan defined2TM; 2TM domain (PF13239; HMM-score: 12)
    FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 11.5)
    P12; Virus attachment protein p12 family (PF12669; HMM-score: 11.1)
    DUF997; Protein of unknown function (DUF997) (PF06196; HMM-score: 10.8)
    Pox_EPC_I2-L1; Poxvirus entry protein complex L1 and I2 (PF12575; HMM-score: 7.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.147
    • Ymax_pos: 11
    • Cmax: 0.142
    • Cmax_pos: 35
    • Smax: 0.306
    • Smax_pos: 2
    • Smean: 0.215
    • D: 0.173
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSLGVKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLILIGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYNKKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPRVL

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [4] [5] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 15.97 h [6]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int. J. Med. Microbiol.: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  5. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  6. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]

Marret Müller, Swantje Reiß, Rabea Schlüter, Ulrike Mäder, Anica Beyer, Wenke Reiß, Jon Marles-Wright, Richard J Lewis, Henrike Pförtner, Uwe Völker, Katharina Riedel, Michael Hecker, Susanne Engelmann, Jan Pané-Farré
Deletion of membrane-associated Asp23 leads to upregulation of cell wall stress genes in Staphylococcus aureus.
Mol. Microbiol.: 2014, 93(6);1259-68
[PubMed:25074408] [WorldCat.org] [DOI] (I p)