From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005580000
  • symbol?: amaP
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 5719081..5719551
  • synteny block?: BlockID0043400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2122
    08BA02176:
    C248_2222
    11819-97:
    MS7_2207
    71193:
    ST398NM01_2244
    ECT-R 2:
    ECTR2_2045
    ED133:
    SAOV_2231c
    ED98:
    SAAV_2245
    HO 5096 0412:
    SAEMRSA15_20890
    JH1:
    SaurJH1_2254
    JH9:
    SaurJH9_2215
    JKD6008:
    SAA6008_02225
    JKD6159:
    SAA6159_02095
    LGA251:
    SARLGA251_19790
    M013:
    M013TW_2150
    MRSA252:
    SAR2275
    MSHR1132:
    SAMSHR1132_20160
    MSSA476:
    SAS2085
    Mu3:
    SAHV_2168
    Mu50:
    SAV2184
    MW2:
    MW2110
    RF122:
    SAB2065c
    ST398:
    SAPIG2244
    T0131:
    SAT0131_02357 (sspB)
    TCH60:
    HMPREF0772_11007
    TW20:
    SATW20_23220
    USA300_TCH1516:
    USA300HOU_2177
    VC40:
    SAVC_09810

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSLGVKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLIL
    N315            ----MKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLIL
    NCTC8325        ----MKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLIL
    Newman          MSLGVKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLIL
    USA300_FPR3757  MSLGVKRLKNFILGLLIVVIVGFLLFMYIQDGRITEYQDYFLQFEWFQPLLISLAALLIL
                        :*******************************************************

    COL             IGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYN
    N315            IGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYN
    NCTC8325        IGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYN
    Newman          IGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYN
    USA300_FPR3757  IGLILVFSIFKPTHRKPGLYKDFDDGHVYVSRKAVEKTAFDTVAKYDQVRQPNVVAKLYN
                    ************************************************************

    COL             KKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPR
    N315            KKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPR
    NCTC8325        KKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPR
    Newman          KKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPR
    USA300_FPR3757  KKNKSYIDIKTDFFVPNNVQVQSLTEAIRSDIKKNVEYFTEMPVRKLEVNVRDQKTSGPR
                    ************************************************************

    COL             VL
    N315            VL
    NCTC8325        VL
    Newman          VL
    USA300_FPR3757  VL
                    **