From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2179 [new locus tag: SACOL_RS11465 ]
  • pan locus tag?: SAUPAN005584000
  • symbol: SACOL2179
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2179 [new locus tag: SACOL_RS11465 ]
  • symbol: SACOL2179
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2261369..2262238
  • length: 870
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    GTGAAGAAAATTTTTGTAATTATTACGACATTGTTAGCGGTCGCTATTATTATAGGCTCT
    ATTATTATGGTGGTGTTTAGTCAACGACAGGCACAAACATTTAAAATACAACAACAGCAA
    TTTGTTAAAAAGCCAATTCCAACATTGTTCTTACATGGATTTGGTGGTAGTGCCAATTCT
    GAAAAGTTTATGGTGAAGCAAGCAGAAAAAAGAGGGGTAACTAAAGATATCATCACTGCT
    TACGTTTCAAAGGATGGTGCAGTGACATTTAAAGGGAAACTAAGAAAAGATGCAGTGAAT
    CCTATTGTGAAAATTGAACTTGAAAATAACAGACAAGGCTATTTGGATAAGAATGCTGCG
    TGGTTTAAAAATGTACTGACTAAGTTACAATCTGAATACAATTTCGATAAATTCAACTTT
    GTCGGTCACTCAATGGGGAACTTAACATTTGCACAATATATGATGACATATGGTAACGAC
    AAGTCACTGCCACAGTTAAACAAACAAGTGAATATTGCAGGGACATTTAATGGTGTTTTA
    AATATGAATGAAGATGTCAATGAAATTACAGTTGATAAAGATGGTAAACCAAGTCGAATG
    AATCAACCTTATCAGCAATTACGCGTGCTAAAAGATATTTATAAAGGTAAAGGTATCGAA
    GTGCTAAATATTTATGGGGATTTGAAAGATGGTACACATTCAGACGGCAGAGTGTCTAAT
    AGTTCTTCGAAATCATTAAAATATTTACTGGGAAATAGTCCGAAAAGTTATCGAGAATCT
    AAATATGAAGGTGAGCCTGCACAACATAGTCAGCTTCATGAGAATGAAAATTTTGCTAAT
    GAGTTAATCGACTTCTTATGGAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    870

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2179 [new locus tag: SACOL_RS11465 ]
  • symbol: SACOL2179
  • description: hypothetical protein
  • length: 289
  • theoretical pI: 10.1106
  • theoretical MW: 32763.4
  • GRAVY: -0.461246

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    cell surface hydrolase (putative) 
  • PFAM:
    AB_hydrolase (CL0028) DUF915; Alpha/beta hydrolase of unknown function (DUF915) (PF06028; HMM-score: 340.6)
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 16.1)
    DUF676; Putative serine esterase (DUF676) (PF05057; HMM-score: 15.7)
    no clan definedDAG1; Dystroglycan (Dystrophin-associated glycoprotein 1) (PF05454; HMM-score: 13.4)
    AB_hydrolase (CL0028) DUF900; Alpha/beta hydrolase of unknown function (DUF900) (PF05990; HMM-score: 12.1)
    Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: IQQQQFVK
  • SignalP: Signal peptide length 32 aa
    • Ymax: 0.507
    • Ymax_pos: 32
    • Cmax: 0.6
    • Cmax_pos: 32
    • Smax: 0.639
    • Smax_pos: 2
    • Smean: 0.444
    • D: 0.482
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKIFVIITTLLAVAIIIGSIIMVVFSQRQAQTFKIQQQQFVKKPIPTLFLHGFGGSANSEKFMVKQAEKRGVTKDIITAYVSKDGAVTFKGKLRKDAVNPIVKIELENNRQGYLDKNAAWFKNVLTKLQSEYNFDKFNFVGHSMGNLTFAQYMMTYGNDKSLPQLNKQVNIAGTFNGVLNMNEDVNEITVDKDGKPSRMNQPYQQLRVLKDIYKGKGIEVLNIYGDLKDGTHSDGRVSNSSSKSLKYLLGNSPKSYRESKYEGEPAQHSQLHENENFANELIDFLWKK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]