From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS11465 [old locus tag: SACOL2179 ]
  • pan locus tag?: SAUPAN005584000
  • symbol: SACOL_RS11465
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS11465 [old locus tag: SACOL2179 ]
  • symbol: SACOL_RS11465
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2261369..2262253
  • length: 885
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2261369..2262253) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGGGAGTTAAAAGTGTGAAGAAAATTTTTGTAATTATTACGACATTGTTAGCGGTCGCT
    ATTATTATAGGCTCTATTATTATGGTGGTGTTTAGTCAACGACAGGCACAAACATTTAAA
    ATACAACAACAGCAATTTGTTAAAAAGCCAATTCCAACATTGTTCTTACATGGATTTGGT
    GGTAGTGCCAATTCTGAAAAGTTTATGGTGAAGCAAGCAGAAAAAAGAGGGGTAACTAAA
    GATATCATCACTGCTTACGTTTCAAAGGATGGTGCAGTGACATTTAAAGGGAAACTAAGA
    AAAGATGCAGTGAATCCTATTGTGAAAATTGAACTTGAAAATAACAGACAAGGCTATTTG
    GATAAGAATGCTGCGTGGTTTAAAAATGTACTGACTAAGTTACAATCTGAATACAATTTC
    GATAAATTCAACTTTGTCGGTCACTCAATGGGGAACTTAACATTTGCACAATATATGATG
    ACATATGGTAACGACAAGTCACTGCCACAGTTAAACAAACAAGTGAATATTGCAGGGACA
    TTTAATGGTGTTTTAAATATGAATGAAGATGTCAATGAAATTACAGTTGATAAAGATGGT
    AAACCAAGTCGAATGAATCAACCTTATCAGCAATTACGCGTGCTAAAAGATATTTATAAA
    GGTAAAGGTATCGAAGTGCTAAATATTTATGGGGATTTGAAAGATGGTACACATTCAGAC
    GGCAGAGTGTCTAATAGTTCTTCGAAATCATTAAAATATTTACTGGGAAATAGTCCGAAA
    AGTTATCGAGAATCTAAATATGAAGGTGAGCCTGCACAACATAGTCAGCTTCATGAGAAT
    GAAAATTTTGCTAATGAGTTAATCGACTTCTTATGGAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    885

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS11465 [old locus tag: SACOL2179 ]
  • symbol: SACOL_RS11465
  • description: hypothetical protein
  • length: 294
  • theoretical pI: 10.1578
  • theoretical MW: 33233.9
  • GRAVY: -0.442177

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    AB_hydrolase (CL0028) DUF915; Alpha/beta hydrolase of unknown function (DUF915) (PF06028; HMM-score: 340.5)
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 16)
    DUF676; Putative serine esterase (DUF676) (PF05057; HMM-score: 15.7)
    no clan definedDAG1; Dystroglycan (Dystrophin-associated glycoprotein 1) (PF05454; HMM-score: 13.6)
    AB_hydrolase (CL0028) DUF900; Alpha/beta hydrolase of unknown function (DUF900) (PF05990; HMM-score: 12)
    no clan definedDUF3671; Protein of unknown function (PF12420; HMM-score: 11.8)
    AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.461
    • Ymax_pos: 37
    • Cmax: 0.568
    • Cmax_pos: 37
    • Smax: 0.604
    • Smax_pos: 3
    • Smean: 0.407
    • D: 0.44
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_023487187 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MGVKSVKKIFVIITTLLAVAIIIGSIIMVVFSQRQAQTFKIQQQQFVKKPIPTLFLHGFGGSANSEKFMVKQAEKRGVTKDIITAYVSKDGAVTFKGKLRKDAVNPIVKIELENNRQGYLDKNAAWFKNVLTKLQSEYNFDKFNFVGHSMGNLTFAQYMMTYGNDKSLPQLNKQVNIAGTFNGVLNMNEDVNEITVDKDGKPSRMNQPYQQLRVLKDIYKGKGIEVLNIYGDLKDGTHSDGRVSNSSSKSLKYLLGNSPKSYRESKYEGEPAQHSQLHENENFANELIDFLWKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS11465 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]