From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2294 [new locus tag: SACOL_RS12065 ]
  • pan locus tag?: SAUPAN005771000
  • symbol: SACOL2294
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2294 [new locus tag: SACOL_RS12065 ]
  • symbol: SACOL2294
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2355393..2355815
  • length: 423
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGACAACTGAAATGAACGACGTAACAAATCATCAACCGAATCGCAAATCCAATGATGAG
    AACATTATGGCGATGCTTATCTATTTATTAAGTTTATTCACATCTATTATTGGTCCACTG
    ATAATATGGTTATTGAAAAAAGATGAATCGAAACTAGTTGATCGTGCTGGAAAAAATTAT
    CTTAACTATACGATTTCTTATATTATTTGGTCTATCGTTTTAGTCGTTATCACTTTAATA
    GGCGTTTTCCTAATTGCTACAGATATTGATTTCATTATTATTATAGGTTTCATCATTACG
    TTTATCGGTATTTTATCCATATTCGCTTTCTCAATATTATCTTTTGTATTCACAATTATT
    GCGTGTGTCAAATATTATAATGGCCAAGAATATATAATACCTTTAACAATTCGATTTATT
    TAA
    60
    120
    180
    240
    300
    360
    420
    423

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2294 [new locus tag: SACOL_RS12065 ]
  • symbol: SACOL2294
  • description: hypothetical protein
  • length: 140
  • theoretical pI: 5.78375
  • theoretical MW: 16052.1
  • GRAVY: 0.930714

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Hypothetical protein SAV2303 
  • PFAM:
    no clan definedDUF4870; Domain of unknown function (DUF4870) (PF09685; HMM-score: 97.2)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 20.1)
    Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 19.8)
    no clan definedDUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 17.7)
    FA_desaturase; Fatty acid desaturase (PF00487; HMM-score: 13)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 11.8)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 10.3)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 7.1)
    Holin-II (CL0563) Phage_holin_2_4; Bacteriophage holin family, superfamily II-like (PF16082; HMM-score: 5.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.135
    • Ymax_pos: 48
    • Cmax: 0.117
    • Cmax_pos: 48
    • Smax: 0.263
    • Smax_pos: 43
    • Smean: 0.118
    • D: 0.128
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTTEMNDVTNHQPNRKSNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAGKNYLNYTISYIIWSIVLVVITLIGVFLIATDIDFIIIIGFIITFIGILSIFAFSILSFVFTIIACVKYYNGQEYIIPLTIRFI

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Integral membrane [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]