From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005771000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 5862423..5862854
  • synteny block?: BlockID0045170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2241
    08BA02176:
    C248_2342
    11819-97:
    MS7_2320
    71193:
    ST398NM01_2353
    ECT-R 2:
    ECTR2_2162
    ED133:
    SAOV_2342
    ED98:
    SAAV_2364
    HO 5096 0412:
    SAEMRSA15_22000
    JH1:
    SaurJH1_2369
    JH9:
    SaurJH9_2326
    JKD6008:
    SAA6008_02338
    JKD6159:
    SAA6159_02206
    LGA251:
    SARLGA251_20850
    M013:
    M013TW_2259
    MRSA252:
    SAR2387
    MSHR1132:
    SAMSHR1132_21270
    MSSA476:
    SAS2193
    Mu3:
    SAHV_2287
    Mu50:
    SAV2303
    MW2:
    MW2221
    RF122:
    SAB2175
    ST398:
    SAPIG2353
    T0131:
    SAT0131_02481
    TCH60:
    HMPREF0772_10895
    TW20:
    SATW20_24330
    USA300_TCH1516:
    USA300HOU_2284
    VC40:
    SAVC_10370

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTEMNDVTNHQPNRKSNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAGKNY
    N315            MTTEMNDVTNHQPNRKSNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAGKNY
    NCTC8325        MTTEMNDVTNHQPNRKSNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAGKNY
    Newman          MTTEMNDVTNHQPNRKSNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAGKNY
    USA300_FPR3757  MTTEMNDVTNHQPNRKSNDENIMAMLIYLLSLFTSIIGPLIIWLLKKDESKLVDRAGKNY
                    ************************************************************

    COL             LNYTISYIIWSIVLVVITLIGVFLIATDIDFIIIIGFIITFIGILSIFAFSILSFVFTII
    N315            LNYTISYIIWSIVLVVITLIGVFLIATDISFIIIIGFIITFIGILSIFAFSILSFVFTII
    NCTC8325        LNYTISYIIWSIVLVVITLIGVFLIATDIDFIIIIGFIITFIGILSIFAFSILSFVFTII
    Newman          LNYTISYIIWSIVLVVITLIGVFLIATDIDFIIIIGFIITFIGILSIFAFSILSFVFTII
    USA300_FPR3757  LNYTISYIIWSIVLVVITLIGVFLIATDIDFIIIIGFIITFIGILSIFAFSILSFVFTII
                    *****************************.******************************

    COL             ACVKYYNGQEYIIPLTIRFI
    N315            ACVKYYNGQEYVIPLTIRFI
    NCTC8325        ACVKYYNGQEYIIPLTIRFI
    Newman          ACVKYYNGQEYIIPLTIRFI
    USA300_FPR3757  ACVKYYNGQEYIIPLTIRFI
                    ***********:********