From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2411 [new locus tag: SACOL_RS12650 ]
  • pan locus tag?: SAUPAN005947000
  • symbol: SACOL2411
  • pan gene symbol?: tcyB
  • synonym:
  • product: amino acid ABC transporter permease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2411 [new locus tag: SACOL_RS12650 ]
  • symbol: SACOL2411
  • product: amino acid ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 2470616..2471344
  • length: 729
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    TTGGTCAAGATGTTTCTAAATCTAAATAGTGAACAACAACATGCGCTAGATGCTGCAAAA
    CAAGCTTTCGGACCTATGCTAGAAGGTTTGGTCAAATATTCAATTCCTATTACATTAGTT
    ACATTTGTTTTAGGATTGATTATTGCATTATTTACAGCATTAATGCGAATTTCAACGAGT
    AAAATTTTAAGAAGTATTTCACGTGTCTATGTATCTATTATTCGAGGAACACCAATGATA
    GTACAACTATTTATCATATTTTATGGTATTCCAGAATTAGGTAGATTATTAACAAATGAC
    GCTGACAACCAATGGACATTGGCACCTGTAGTGGCTGCTATTATTGGTTTATCATTAAAT
    GTAGGTGCGTATGCTTCGGAAATTATTCGTGGCGGTATTATTTCTATACCGAAAGGACAA
    ACAGAAGCTGCATATTCCATCGGTATGACGTATGGTCAAACGATACAACGTATCATTTTA
    CCGCAGGCAATTCGAGTGTCGATTCCTGCACTAGGTAATACATTTTTAAGTTTAATCAAA
    GATACATCATTATTAGGATTTATTTTAGTGGCTGAAATGTTTAGAAAAGCTCAAGAAGTT
    GCGTCTACAACATATGAATATTTAACAATTTATGTGTTAGTTGCGCTAATGTACTGGGTG
    GTATGCTTTATTATTTCAATTATCCAAGGTATCTATGAATCTTATATTGAAAGAGGGTAT
    CGCTCATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    729

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2411 [new locus tag: SACOL_RS12650 ]
  • symbol: SACOL2411
  • description: amino acid ABC transporter permease
  • length: 242
  • theoretical pI: 9.36319
  • theoretical MW: 26800.7
  • GRAVY: 0.683058

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    ectoine/hydroxyectoine ABC transporter, permease protein EhuC (TIGR03004; HMM-score: 159.4)
    ectoine/hydroxyectoine ABC transporter, permease protein EhuD (TIGR03003; HMM-score: 138.2)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesamino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (TIGR01726; HMM-score: 83.7)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, permease protein PstA (TIGR00974; HMM-score: 24.6)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, permease protein PstC (TIGR02138; HMM-score: 20.9)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, permease protein PhnE (TIGR01097; HMM-score: 17.1)
    Cellular processesCellular processesChemotaxis and motilityflagellar biosynthetic protein FliQ (TIGR01402; HMM-score: 15)
    Cellular processesCellular processesPathogenesistype III secretion protein, HrpO family (TIGR01403; HMM-score: 4.7)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype III secretion protein, HrpO family (TIGR01403; HMM-score: 4.7)
  • TheSEED:  
    Sulfur MetabolismOrganic sulfur assimilationL-Cystine Uptake and Metabolism L-Cystine ABC transporter, permease protein TcyB 
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 86.2)
    no clan definedBac_export_3; Bacterial export proteins, family 3 (PF01313; HMM-score: 15.6)
    DUF3377; Domain of unknown function (DUF3377) (PF11857; HMM-score: 12.5)
    WSS_VP; White spot syndrome virus structural envelope protein VP (PF12175; HMM-score: 11.9)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 9.7)
    Oxa1 (CL0376) DUF106; Integral membrane protein DUF106 (PF01956; HMM-score: 9.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.16
    • Ymax_pos: 19
    • Cmax: 0.122
    • Cmax_pos: 19
    • Smax: 0.276
    • Smax_pos: 14
    • Smean: 0.175
    • D: 0.166
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MVKMFLNLNSEQQHALDAAKQAFGPMLEGLVKYSIPITLVTFVLGLIIALFTALMRISTSKILRSISRVYVSIIRGTPMIVQLFIIFYGIPELGRLLTNDADNQWTLAPVVAAIIGLSLNVGAYASEIIRGGIISIPKGQTEAAYSIGMTYGQTIQRIILPQAIRVSIPALGNTFLSLIKDTSLLGFILVAEMFRKAQEVASTTYEYLTIYVLVALMYWVVCFIISIIQGIYESYIERGYRS

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Integral membrane [1] [2]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SACOL1681 (CymR*)
    CymR* (TF) important in Cysteine metabolism

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]