From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2478 [new locus tag: SACOL_RS12990 ]
  • pan locus tag?: SAUPAN006029000
  • symbol: SACOL2478
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2478 [new locus tag: SACOL_RS12990 ]
  • symbol: SACOL2478
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2535227..2536045
  • length: 819
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAATAACTTTAATAATGAAATCAAATTGATATTACAACAATATTTAGAAAAGTTTGAA
    GCGCATTACGAGCGTGTATTACAAGACGATCAATATATCGAAGCATTAGAAACATTGATG
    GATGACTATAGTGAATTTATTTTAAATCCTATTTATGAACAACAATTTAATGCTTGGCGT
    GACGTTGAAGAAAAAGCACAATTAATAAAATCACTGCAATATATTACAGCGCAGTGTGTT
    AAACAAGTGGAAGTCATTAGAGCGAGACGTCTATTAGACGGACAGGCGTCTACCACAGGT
    TACTTTGACAATATAGAACATTGTATTGATGAAGAGTTTGGACAATGTAGTATAGCTAGC
    AATGACAAATTATTGTTAGTTGGTTCAGGTGCATATCCAATGACGTTAATTCAAGTAGCA
    AAAGAAACAGGTGCTTCAGTTATCGGTATTGATATTGATCCACAAGCCGTTGACCTAGGG
    CGCAGAATCGTTAACGTCTTAGCACCAAATGAAGATATAACAATTACGGATCAAAAGGTA
    TCTGAACTTAAAGATATCAAAGATGTGACGCATATCATATTCAGCTCGACAATTCCTTTA
    AAGTACAGCATTTTAGAAGAATTATATGATTTAACAAATGAAAATGTCGTAGTTGCAATG
    CGCTTTGGTGATGGCATCAAAGCAATATTTAATTATCCGTCACAAGAAACAGCGGAAGAT
    AAGTGGCAATGTGTGAATAAACATATGAGACCACAGCAAATTTTTGATATAGCACTTTAT
    AAAAAAGCAGCTATAAAGGTAGGTATTACGGATGTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    819

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2478 [new locus tag: SACOL_RS12990 ]
  • symbol: SACOL2478
  • description: hypothetical protein
  • length: 272
  • theoretical pI: 4.37556
  • theoretical MW: 31096.2
  • GRAVY: -0.212868

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase (TIGR03201; EC 1.1.1.-; HMM-score: 20.7)
    T-complex protein 1, theta subunit (TIGR02346; HMM-score: 14.8)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 13)
    Unknown functionEnzymes of unknown specificityputative methylase (TIGR00537; HMM-score: 13)
    2-aminoethylphosphonate aminotransferase (TIGR03301; EC 2.6.1.-; HMM-score: 13)
  • TheSEED:  
    FIG016157: Similar to nicotianamine synthase 
  • PFAM:
    NADP_Rossmann (CL0063) Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 17.8)
    NAS; Nicotianamine synthase protein (PF03059; HMM-score: 17.6)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 17.3)
    ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 16.1)
    no clan definedNoelin-1; Neurogenesis glycoprotein (PF12308; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.101
    • Ymax_pos: 22
    • Cmax: 0.119
    • Cmax_pos: 22
    • Smax: 0.115
    • Smax_pos: 19
    • Smean: 0.084
    • D: 0.094
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNNFNNEIKLILQQYLEKFEAHYERVLQDDQYIEALETLMDDYSEFILNPIYEQQFNAWRDVEEKAQLIKSLQYITAQCVKQVEVIRARRLLDGQASTTGYFDNIEHCIDEEFGQCSIASNDKLLLVGSGAYPMTLIQVAKETGASVIGIDIDPQAVDLGRRIVNVLAPNEDITITDQKVSELKDIKDVTHIIFSSTIPLKYSILEELYDLTNENVVVAMRFGDGIKAIFNYPSQETAEDKWQCVNKHMRPQQIFDIALYKKAAIKVGITDV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]