From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2545 [new locus tag: SACOL_RS13325 ]
  • pan locus tag?: SAUPAN006184000
  • symbol: sdaAB
  • pan gene symbol?: sdaAB
  • synonym:
  • product: L-serine dehydratase, iron-sulfur-dependent subunit beta

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2545 [new locus tag: SACOL_RS13325 ]
  • symbol: sdaAB
  • product: L-serine dehydratase, iron-sulfur-dependent subunit beta
  • replicon: chromosome
  • strand: -
  • coordinates: 2603013..2603693
  • length: 681
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGCAAAGAGCTATGATTATCAAAGTGCTTTCGATATTATCGGACCAGTTATGATGGGC
    CCTTCAAGTTCTCATACGGCTGGTGCAGTAAAGATTGGGAATTCAGCACGCGCAATATTG
    GGAGATATTCCTAAAAATATTGAAATACATTATTATGAATCATTTGCTCAAACACACCAA
    GGACATGGTACAGATGTCGCTATTGTGGGTGGAGCAATGGGATATTCAACATTTGATAAC
    CGAATTAAATCTTCATTAGAAATTGCAGCTGATGATGGTATTAAAATAGATATCATCGAA
    GAAGAAGGCGATAGTATTGGTCAACATCCAAACTGTGCTTATATCAAATCATCTCGTAAT
    GATGGTCGCTACATTGAAATTATCGGTATTTCAATCGGTGGTGGTACAATTAAAATTAAA
    GGTATTCATATAAATGGACTAGAAGTAGATTTAAATCATGGATTACCAATTTTAGTTGTT
    GACGGAAATATGACTAAAGCACAAGTAAATCATTTCATCAATGATATCAACGATATGAAA
    TTAGACTGTAAAGATGAATTTATTAAGATAGATGAAGATAAATGCTTGGTTGTAATACCA
    TTAAATAAAGCAATCTCAGAATCAACATTAAATACAATTAAAGAGAAATACAGTGACGTA
    AACGTTTCCTATATAAATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    681

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2545 [new locus tag: SACOL_RS13325 ]
  • symbol: SdaAB
  • description: L-serine dehydratase, iron-sulfur-dependent subunit beta
  • length: 226
  • theoretical pI: 4.93024
  • theoretical MW: 24557.6
  • GRAVY: -0.15531

Function[edit source | edit]

  • reaction:
    EC 4.3.1.17?  ExPASy
    L-serine ammonia-lyaseL-serine = pyruvate + NH3
  • TIGRFAM:
    MetabolismEnergy metabolismAmino acids and aminesL-serine dehydratase, iron-sulfur-dependent, beta subunit (TIGR00719; EC 4.3.1.17; HMM-score: 170.8)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesisL-serine dehydratase, iron-sulfur-dependent, beta subunit (TIGR00719; EC 4.3.1.17; HMM-score: 170.8)
    MetabolismEnergy metabolismAmino acids and aminesL-serine ammonia-lyase (TIGR00720; EC 4.3.1.17; HMM-score: 32.4)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesisL-serine ammonia-lyase (TIGR00720; EC 4.3.1.17; HMM-score: 32.4)
  • TheSEED:  
    Amino Acids and DerivativesAlanine, serine, and glycineGlycine and Serine Utilization L-serine dehydratase, beta subunit (EC 4.3.1.17) 
    CarbohydratesCentral carbohydrate metabolismPyruvate Alanine Serine Interconversions L-serine dehydratase, beta subunit (EC 4.3.1.17) 
  • PFAM:
    no clan definedSDH_beta; Serine dehydratase beta chain (PF03315; HMM-score: 46.2)
    Ribokinase (CL0118) ADP_PFK_GK; ADP-specific Phosphofructokinase/Glucokinase conserved region (PF04587; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.24
    • Ymax_pos: 30
    • Cmax: 0.23
    • Cmax_pos: 30
    • Smax: 0.344
    • Smax_pos: 26
    • Smean: 0.181
    • D: 0.217
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAKSYDYQSAFDIIGPVMMGPSSSHTAGAVKIGNSARAILGDIPKNIEIHYYESFAQTHQGHGTDVAIVGGAMGYSTFDNRIKSSLEIAADDGIKIDIIEEEGDSIGQHPNCAYIKSSRNDGRYIEIIGISIGGGTIKIKGIHINGLEVDLNHGLPILVVDGNMTKAQVNHFINDINDMKLDCKDEFIKIDEDKCLVVIPLNKAISESTLNTIKEKYSDVNVSYIN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]