From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006184000
  • symbol?: sdaAB
  • description?: L-serine dehydratase, iron-sulfur-dependent subunit beta

      descriptions from strain specific annotations:

    • L-serine dehydratase, iron-sulfur-dependent subunit beta
    • L-serine dehydratase, iron-sulfur-dependent, beta subunit
    • L-serine dehydratase iron-sulfur-dependent subunit beta
    • beta-subunit of L-serine dehydratase
    • L-serine ammonia-lyase beta subunit
    • L-serine dehydratase, beta subunit
    • L-serine dehydratase beta subunit
    • L-serine dehydratase subunit beta
    • putative L-serine dehydratase, beta chain
  • strand?: -
  • coordinates?: 6248450..6249130
  • synteny block?: BlockID0049090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2545 (sdaAB)
    N315:
    NCTC8325:
    Newman:
    NWMN_2430 (sdhB)
    USA300_FPR3757:
    SAUSA300_2470 (sdaAB)
    04-02981:
    SA2981_2467
    08BA02176:
    C248_2589
    11819-97:
    MS7_2537 (sdaAB)
    71193:
    ST398NM01_2582
    ECT-R 2:
    ECTR2_2383 (sdaAB)
    ED133:
    SAOV_2575c
    ED98:
    SAAV_2597 (sdaAB)
    HO 5096 0412:
    SAEMRSA15_24300
    JH1:
    SaurJH1_2607
    JH9:
    SaurJH9_2555
    JKD6008:
    SAA6008_02569 (sdaAB)
    JKD6159:
    SAA6159_02427 (sdaAB)
    LGA251:
    SARLGA251_23060
    M013:
    M013TW_2503
    MRSA252:
    SAR2611
    MSHR1132:
    SAMSHR1132_23510
    MSSA476:
    SAS2417
    Mu3:
    SAHV_2515
    Mu50:
    SAV2531
    MW2:
    MW2452
    RF122:
    SAB2405c
    ST398:
    SAPIG2582 (sdaAB)
    T0131:
    SAT0131_02736
    TCH60:
    HMPREF0772_10660 (sdaAB)
    TW20:
    SATW20_26520
    USA300_TCH1516:
    USA300HOU_2522 (sdhB2)
    VC40:
    SAVC_11530

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKSYDYQSAFDIIGPVMMGPSSSHTAGAVKIGNSARAILGDIPKNIEIHYYESFAQTHQ
    N315            MAKSYDYQSAFDIIGPVMMGPSSSHTAGAVKIGNSARAILGDIPKNIEIHYYESFAQTHQ
    NCTC8325        MAKSYDYQSAFDIIGPVMMGPSSSHTAGAVKIGNSARAILGDIPKNIEIHYYESFAQTHQ
    Newman          MAKSYDYQSAFDIIGPVMMGPSSSHTAGAVKIGNSARAILGDIPKNIEIHYYESFAQTHQ
    USA300_FPR3757  MAKSYDYQSAFDIIGPVMMGPSSSHTAGAVKIGNSARAILGDIPKNIEIHYYESFAQTHQ
                    ************************************************************

    COL             GHGTDVAIVGGAMGYSTFDNRIKSSLEIAADDGIKIDIIEEEGDSIGQHPNCAYIKSSRN
    N315            GHGTDVAIVGGAMGYSTFDNRIKSSLEIAADDGIKIDIIEEEGDSIGQHPNCAYIKSSRN
    NCTC8325        GHGTDVAIVGGAMGYSTFDNRIKSSLEIAADDGIKIDIIEEEGDSIGQHPNCAYIKSSRN
    Newman          GHGTDVAIVGGAMGYSTFDNRIKSSLEIAADDGIKIDIIEEEGDSIGQHPNCAYIKSSRN
    USA300_FPR3757  GHGTDVAIVGGAMGYSTFDNRIKSSLEIAADDGIKIDIIEEEGDSIGQHPNCAYIKSSRN
                    ************************************************************

    COL             DGRYIEIIGISIGGGTIKIKGIHINGLEVDLNHGLPILVVDGNMTKAQVNHFINDINDMK
    N315            DGRYIEIIGISIGGGTIKIKGIHINGLEVDLNHGLPILVVDGNMTKAQVNHFINDINDMK
    NCTC8325        DGRYIEIIGISIGGGTIKIKGIHINGLEVDLNHGLPILVVDGNMTKAQVNHFINDINDMK
    Newman          DGRYIEIIGISIGGGTIKIKGIHINGLEVDLNHGLPILVVDGNMTKAQVNHFINDINDMK
    USA300_FPR3757  DGRYIEIIGISIGGGTIKIKGIHINGLEVDLNHGLPILVVDGNMTKAQVNHFINDINDMK
                    ************************************************************

    COL             LDCKDEFIKIDEDKCLVVIPLNKAISESTLNTIKEKYSDVNVSYIN
    N315            LDCKDEFIKIDEDKCLVVIPLNKAISESTLNTIKEKYSDVNVSYIN
    NCTC8325        LDCKDEFIKIDEDKCLVVIPLNKAISESTLNTIKEKYSDVNVSYIN
    Newman          LDCKDEFIKIDEDKCLVVIPLNKAISESTLNTIKEKYSDVNVSYIN
    USA300_FPR3757  LDCKDEFIKIDEDKCLVVIPLNKAISESTLNTIKEKYSDVNVSYIN
                    **********************************************