From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2590 [new locus tag: SACOL_RS13565 ]
  • pan locus tag?: SAUPAN006248000
  • symbol: SACOL2590
  • pan gene symbol?:
  • synonym:
  • product: glyoxalase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2590 [new locus tag: SACOL_RS13565 ]
  • symbol: SACOL2590
  • product: glyoxalase
  • replicon: chromosome
  • strand: -
  • coordinates: 2653392..2653769
  • length: 378
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATTCAATCAATGTGGTTTAATTTGCATGTGCAAGATTTAGAAAAGAGCGCACAGTTT
    TATAAAGCGTTAGGATTTAAAATAAATAGAAACCCACAAATGTTAGATAAAATGGTCGGC
    ATTCAAATAGGTCAAACAACCGTAATTTTAATAGAAAACAAGCATTTTCAAAATGTAAGT
    CAGCAAAGCCTTAATACTGAACCAAATGAAGTGATGATTTCTCTAGGTGTGAACACAAAT
    GAAGAAGTTGACCAGTTGGTGAATAAAGTGAAAGAAGCGGGTGGCACAGTCGTTCAAGAA
    CCAACAGTAAGCCAAGGGTTTTATGGAGCAATGTTCAAAGATCTTGATGGACACCATTTT
    AATTTTTTGGTCTGCTAA
    60
    120
    180
    240
    300
    360
    378

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2590 [new locus tag: SACOL_RS13565 ]
  • symbol: SACOL2590
  • description: glyoxalase
  • length: 125
  • theoretical pI: 5.54363
  • theoretical MW: 14160.1
  • GRAVY: -0.2224

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    3,4-dihydroxyphenylacetate 2,3-dioxygenase (TIGR02295; EC 1.13.11.15; HMM-score: 23.8)
    MetabolismEnergy metabolismOtherlactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 23)
    MetabolismCentral intermediary metabolismAmino sugarslactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 23)
  • TheSEED:  
    hypothetical protein 
  • PFAM:
    Glyoxalase (CL0104) Glyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 32.9)
    Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 14.3)
    3-dmu-9_3-mt; 3-demethylubiquinone-9 3-methyltransferase (PF06983; HMM-score: 13.6)
    no clan definedSpc24; Spc24 subunit of Ndc80 (PF08286; HMM-score: 13.2)
    BRCT-like (CL0459) BRCT; BRCA1 C Terminus (BRCT) domain (PF00533; HMM-score: 13)
    Peptidase_MH (CL0035) Peptidase_M42; M42 glutamyl aminopeptidase (PF05343; HMM-score: 12.7)
    P-loop_NTPase (CL0023) ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.13
    • Ymax_pos: 19
    • Cmax: 0.119
    • Cmax_pos: 19
    • Smax: 0.208
    • Smax_pos: 50
    • Smean: 0.125
    • D: 0.128
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIQSMWFNLHVQDLEKSAQFYKALGFKINRNPQMLDKMVGIQIGQTTVILIENKHFQNVSQQSLNTEPNEVMISLGVNTNEEVDQLVNKVKEAGGTVVQEPTVSQGFYGAMFKDLDGHHFNFLVC

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]