From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2615 [new locus tag: SACOL_RS13680 ]
  • pan locus tag?: SAUPAN006293000
  • symbol: panB
  • pan gene symbol?: panB
  • synonym:
  • product: 3-methyl-2-oxobutanoate hydroxymethyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2615 [new locus tag: SACOL_RS13680 ]
  • symbol: panB
  • product: 3-methyl-2-oxobutanoate hydroxymethyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2671595..2672413
  • length: 819
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    TTGAAAACAGTAAGTCAATTAATAGATATGAAACAAAAGGAAACTAAAATTTCTATGGTA
    ACAGCTTATGATTTTCCAAGTGCTAAACAAGTGGAAGCAGCGGGTATTGATATGATTCTT
    GTTGGGGATTCACTTGGTATGACTGTATTAGGTTATGAAAGTACCGTACAAGTGACGTTA
    GCAGATATGATTCATCACGGTCGTGCAGTAAGAAGAGGCGCACCAAATACATTTGTAGTT
    GTTGATATGCCGATTGGTGCAGTAGGCATCTCTATGACACAAGACTTAAATCATGCTCTA
    AAGCTTTATCAGGAGACGAATGCAAATGCAATTAAAGCAGAAGGAGCGCATATTACACCA
    TTTATTGAAAAAGCAACGGCAATTGGTATTCCTGTTGTTGCACATTTAGGATTAACACCT
    CAAAGTGTTGGCGTTATGGGGTATAAATTACAAGGTGCAACGAAAGAAGCAGCGGAGCAA
    CTTATTTTAGACGCGAAAAATGTAGAACAAGCTGGTGCAGTTGCGTTAGTACTTGAAGCA
    ATTCCAAATGATTTAGCAGAAGAAATTAGCAAGCACTTAACAATTCCAGTCATTGGTATT
    GGTGCAGGAAAAGGTACAGATGGTCAAGTATTGGTTTATCACGATATGTTAAATTATGGT
    GTTGAACATAAAGCGAAATTTGTGAAGCAATTTGCTGATTTTAGTGTTGGTGTGGATGGT
    TTAAAACAATACGATCAAGAAGTTAAATCTGGTGCATTTCCATCAGAAGAATATACGTAT
    AAAAAGAAAATTATGAATGAGGTTAATAACAATGACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    819

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2615 [new locus tag: SACOL_RS13680 ]
  • symbol: PanB
  • description: 3-methyl-2-oxobutanoate hydroxymethyltransferase
  • length: 272
  • theoretical pI: 5.58058
  • theoretical MW: 29256.4
  • GRAVY: -0.0161765

Function[edit source | edit]

  • reaction:
    EC 2.1.2.11?  ExPASy
    3-methyl-2-oxobutanoate hydroxymethyltransferase5,10-methylenetetrahydrofolate + 3-methyl-2-oxobutanoate + H2O = tetrahydrofolate + 2-dehydropantoate
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme A3-methyl-2-oxobutanoate hydroxymethyltransferase (TIGR00222; EC 2.1.2.11; HMM-score: 297.5)
    MetabolismEnergy metabolismAmino acids and aminesaspartate racemase (TIGR00035; EC 5.1.1.13; HMM-score: 13.6)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsCoenzyme ACoenzyme A Biosynthesis 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 
    Folate and pterinesFolate Biosynthesis 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 
  • PFAM:
    PK_TIM (CL0151) Pantoate_transf; Ketopantoate hydroxymethyltransferase (PF02548; HMM-score: 324.4)
    PEP_mutase; Phosphoenolpyruvate phosphomutase (PF13714; HMM-score: 19.4)
    TIM_barrel (CL0036) NanE; Putative N-acetylmannosamine-6-phosphate epimerase (PF04131; HMM-score: 15.6)
    Leu-IlvD (CL0364) PA; PA domain (PF02225; HMM-score: 13.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.204
    • Ymax_pos: 34
    • Cmax: 0.353
    • Cmax_pos: 34
    • Smax: 0.238
    • Smax_pos: 6
    • Smean: 0.154
    • D: 0.184
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKTVSQLIDMKQKETKISMVTAYDFPSAKQVEAAGIDMILVGDSLGMTVLGYESTVQVTLADMIHHGRAVRRGAPNTFVVVDMPIGAVGISMTQDLNHALKLYQETNANAIKAEGAHITPFIEKATAIGIPVVAHLGLTPQSVGVMGYKLQGATKEAAEQLILDAKNVEQAGAVALVLEAIPNDLAEEISKHLTIPVIGIGAGKGTDGQVLVYHDMLNYGVEHKAKFVKQFADFSVGVDGLKQYDQEVKSGAFPSEEYTYKKKIMNEVNNND

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 677 [4]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 20.8 h [5]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]