From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2660 [new locus tag: SACOL_RS13935 ]
  • pan locus tag?: SAUPAN006369000
  • symbol: isaB
  • pan gene symbol?: isaB
  • synonym:
  • product: immunodominant antigen B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2660 [new locus tag: SACOL_RS13935 ]
  • symbol: isaB
  • product: immunodominant antigen B
  • replicon: chromosome
  • strand: -
  • coordinates: 2722803..2723330
  • length: 528
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAATAAAACCAGTAAAGTTTGTGTAGCAGCAACATTAGCATTGGGCACACTGATTGGA
    GTAACAGTTGTTGAAAATTCGGCGCCAACAAGTAAACAGGCACAGGCAGCAATAACCCCA
    TATTATACTTATAATGGTTATATTGGTAATAATGCTAATTTTATTCTGGATAAGAATTTT
    ATTAACGCGATTAAGTATGATAATGTGAAATTCAATGGTATTAAATTAGCTAAAACGAAT
    ACGATAAAAAAAGTAGAGAAATATGATCAAACTTTTAAAGGTGTTTCTGCAAAAGGAAAC
    GAAGCAAGTCAATTGCAATTTGTAGTTAAAAATAATATTTCATTAAAAGATATCCAAAAA
    GCTTATGGCAAGGACTTGAAAAAAGAAAATGGTAAAACAAAGGAAGCTGATAGCGGTATT
    TTTTACTATCAAAATGCTAAAAAGACATTAGGCATCTGGTTTGTCGTTGATCATAATAGA
    GTTGTCGAAGTAACAGTTGGACATACACCATACAAAACAAGTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    528

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2660 [new locus tag: SACOL_RS13935 ]
  • symbol: IsaB
  • description: immunodominant antigen B
  • length: 175
  • theoretical pI: 10.2294
  • theoretical MW: 19370
  • GRAVY: -0.410857

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    immunodominant antigen B 
  • PFAM:

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 37 aa
    • Ymax: 0.613
    • Ymax_pos: 37
    • Cmax: 0.595
    • Cmax_pos: 37
    • Smax: 0.934
    • Smax_pos: 19
    • Smean: 0.79
    • D: 0.682
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKTSKVCVAATLALGTLIGVTVVENSAPTSKQAQAAITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 29.73 h [5]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]