From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS00165 [old locus tag: SACOL0028 ]
  • pan locus tag?: SAUPAN000054000
  • symbol: SACOL_RS00165
  • pan gene symbol?: tnp
  • synonym:
  • product: IS6 family transposase IS431mec

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS00165 [old locus tag: SACOL0028 ]
  • symbol: SACOL_RS00165
  • product: IS6 family transposase IS431mec
  • replicon: chromosome
  • strand: -
  • coordinates: 36353..37027
  • length: 675
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (36353..37027) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAACTATTTCAGATATAAACAATTTAACAAGGATGTTATCACTGTAGCCGTTGGCTAC
    TATCTAAGATATACATTGAGTTATCGTGATATATCTGAAATATTAAGGGAACGTGGTGTA
    AACGTTCATCATTCAACGGTCTACCGTTGGGTTCAAGAATATGCCCCAATTTTGTATCAA
    ATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATC
    AAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATGCAGAGGGACATACATTA
    GATATTTGGTTGCGTAAGCAACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTC
    ATTAAACAATTTGGTAAACCTCAAAAGGTAATTACAGATCAGGCACCTTCAACGAAGGTA
    GCAATGGCTAAAGTAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACATCGAAA
    TATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGGTAT
    CAAAGTATCAATACAGCAAAGAATACTTTAAAAGGTATTGAATGTATTTACGCTCTATAT
    AAAAAGAACCGCAGGTCTCTTCAGATCTACGGATTTTCGCCATGCCACGAAATTAGCATC
    ATGCTAGCAAGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS00165 [old locus tag: SACOL0028 ]
  • symbol: SACOL_RS00165
  • description: IS6 family transposase IS431mec
  • length: 224
  • theoretical pI: 10.427
  • theoretical MW: 26915.2
  • GRAVY: -0.601339

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    RNase_H (CL0219) DDE_Tnp_IS240; DDE domain (PF13610; HMM-score: 133.2)
    rve; Integrase core domain (PF00665; HMM-score: 54.7)
    DDE_Tnp_IS66; Transposase IS66 family (PF03050; HMM-score: 18.8)
    HTH (CL0123) HTH_32; Homeodomain-like domain (PF13565; HMM-score: 18.4)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.3)
    RNase_H (CL0219) DDE_3; DDE superfamily endonuclease (PF13358; HMM-score: 16.9)
    HTH (CL0123) HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 16.1)
    HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 14.1)
    no clan definedMelibiase_2_C; Alpha galactosidase A C-terminal beta sandwich domain (PF17450; HMM-score: 12.9)
    HEM4; Uroporphyrinogen-III synthase HemD (PF02602; HMM-score: 12.7)
    DUF1580; Protein of unknown function (DUF1580) (PF07618; HMM-score: 12.5)
    HTH (CL0123) HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 6.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.122
    • Ymax_pos: 11
    • Cmax: 0.107
    • Cmax_pos: 30
    • Smax: 0.245
    • Smax_pos: 1
    • Smean: 0.133
    • D: 0.126
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447028801 NCBI
  • RefSeq: WP_001106057 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNYFRYKQFNKDVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS00165 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]