From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS00550 [old locus tag: SACOL0110 ]
  • pan locus tag?: SAUPAN000928000
  • symbol: SACOL_RS00550
  • pan gene symbol?:
  • synonym:
  • product: MFS transporter

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS00550 [old locus tag: SACOL0110 ]
  • symbol: SACOL_RS00550
  • product: MFS transporter
  • replicon: chromosome
  • strand: +
  • coordinates: 125531..126157
  • length: 627
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (125531..126157) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGAAAAAAATGTAGAAAAATCATTCATAAAGATAGGTTTATATTTTCAAATAGCTTAT
    ATAGTACTCATGGCTATAACTTTATGTGGGTTTGTAATTTGCTATGGACTAATTTTCGGC
    CTTTTCTATTTATTATCAGGTAGCAGAGCTGATTATTTAATAGTAACAATAGTTATATCG
    GCAATAATTTCTATATTTGTAATTATACTTTCAATCGTACCTGTCATCGTATTGGCATCT
    GACTTATTTAAAGAAAGGATTTCAAAAGGTGTCATATTAATTGTATTGGCTATTATCGCT
    TTAGTATTATGCAACTTTGTATCTGCAATACTCTGGTTTGTTTCAGCCATATCTATTTTA
    GGTAGAAAAAAATTAGTAGCTGCAGCAGATACTACCACTATTCAAAAAAGTAAAGGGAAC
    GCAAATCAAGCATCACATAAAGACACGTGTAAAAAGGAACTTGATAGTCAAGACATGATG
    GAACATCCTGAGGTTAAAAATCCCACGACTAAAAACCTTGAAGGATTTAACGAAGAAATA
    CATAAAGATGAAGCTACAACTAAAGTTGTCAGTGATAACACGGAACCGCCTATTGAATCA
    AAAGACCATGTCTCGAAAAAAGATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS00550 [old locus tag: SACOL0110 ]
  • symbol: SACOL_RS00550
  • description: MFS transporter
  • length: 208
  • theoretical pI: 7.44922
  • theoretical MW: 22980
  • GRAVY: 0.455288

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 20.7)
    XrtN system VIT domain protein (TIGR04477; HMM-score: 3.2)
    oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 2.7)
  • TheSEED:
  • PFAM:
    no clan definedDUF2448; Protein of unknown function C-terminus (DUF2448) (PF10476; HMM-score: 12.3)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 10.6)
    Trigger_C (CL0262) SurA_N_3; SurA N-terminal domain (PF13624; HMM-score: 10.3)
    no clan definedEOS1; N-glycosylation protein (PF12326; HMM-score: 10.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.084
    • Ymax_pos: 11
    • Cmax: 0.207
    • Cmax_pos: 51
    • Smax: 0.097
    • Smax_pos: 2
    • Smean: 0.066
    • D: 0.077
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI: 446336773 NCBI
  • RefSeq: WP_000414628 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MEKNVEKSFIKIGLYFQIAYIVLMAITLCGFVICYGLIFGLFYLLSGSRADYLIVTIVISAIISIFVIILSIVPVIVLASDLFKERISKGVILIVLAIIALVLCNFVSAILWFVSAISILGRKKLVAAADTTTIQKSKGNANQASHKDTCKKELDSQDMMEHPEVKNPTTKNLEGFNEEIHKDEATTKVVSDNTEPPIESKDHVSKKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS00550 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]