From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01855 [old locus tag: SACOL0369 ]
  • pan locus tag?: SAUPAN001832000
  • symbol: SACOL_RS01855
  • pan gene symbol?:
  • synonym:
  • product: ATP-dependent Clp protease ClpP

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS01855 [old locus tag: SACOL0369 ]
  • symbol: SACOL_RS01855
  • product: ATP-dependent Clp protease ClpP
  • replicon: chromosome
  • strand: +
  • coordinates: 377145..377918
  • length: 774
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (377145..377918) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGTCAATGAAAGCTAAGTATTTTCAAATGAAAAGAAAATCAAAAAGTAAAGGTGAAATA
    TTTATTTATGGTGATATTGTAAGTGATAAATGGTTTGAAAGTGATGTAACTGCTACAGAT
    TTCAAAAATAAACTAGATGAACTAGGAGACATCAGTGAAATAGATGTTCATATAAATTCA
    TCTGGAGGCAGTGTATTTGAAGGGCATGCAATATACAATATGCTAAAAATGCATCCTGCA
    AAAATTAATATCTATGTCGATGCTTTAGCGGCATCAATTGCTAGTGTTATCGCTATGAGT
    GGTGACACTATTTTTATGCACAAAAATAGTTTTTTAATGATTCATAATTCATGGGTTATG
    ACTGTAGGTAATGCAGAAGAATTAAGAAAGACAGCGGATTTACTTGAAAAAACAGATGCT
    GTTAGTAATTCAGCTTATTTAGATAAAGCAAAAGATTTAGATCAAGAACACTTAAAACAG
    ATGTTAGATGCAGAAACTTGGCTTACTGCAGAAGAAGCCTTGTCTTTCGGCTTGATAGAT
    GAAATTTTAGGAGCTAATGAAATAGCTGCTAGTATCTCTAAAGAGCAATATAAGCGTTTC
    GAGAACGTCCCAGAAGATTTAAAGAAAGATGTAGACAAAATCACTAAAATTGATGATGTA
    GATACATCTGAATTGGTTGAAACACCTAAAGAAAGTATGTCACTAGAAGAAAAAGAAAAA
    AGAGAAAAAATTAAACGCGAATGCGAAATTTTAAAAATGACAATGAATTATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    774

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS01855 [old locus tag: SACOL0369 ]
  • symbol: SACOL_RS01855
  • description: ATP-dependent Clp protease ClpP
  • length: 257
  • theoretical pI: 4.71323
  • theoretical MW: 29170.1
  • GRAVY: -0.42179

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesATP-dependent Clp endopeptidase, proteolytic subunit ClpP (TIGR00493; EC 3.4.21.92; HMM-score: 51.8)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidessignal peptide peptidase SppA, 36K type (TIGR00706; EC 3.4.-.-; HMM-score: 35.8)
  • TheSEED:
  • PFAM:
    ClpP_crotonase (CL0127) CLP_protease; Clp protease (PF00574; HMM-score: 105.7)
    SDH_sah; Serine dehydrogenase proteinase (PF01972; HMM-score: 26.3)
    Peptidase_S49; Peptidase family S49 (PF01343; HMM-score: 17.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.222
    • Ymax_pos: 11
    • Cmax: 0.111
    • Cmax_pos: 39
    • Smax: 0.617
    • Smax_pos: 2
    • Smean: 0.478
    • D: 0.322
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 445984011 NCBI
  • RefSeq: WP_000061866 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSMKAKYFQMKRKSKSKGEIFIYGDIVSDKWFESDVTATDFKNKLDELGDISEIDVHINSSGGSVFEGHAIYNMLKMHPAKINIYVDALAASIASVIAMSGDTIFMHKNSFLMIHNSWVMTVGNAEELRKTADLLEKTDAVSNSAYLDKAKDLDQEHLKQMLDAETWLTAEEALSFGLIDEILGANEIAASISKEQYKRFENVPEDLKKDVDKITKIDDVDTSELVETPKESMSLEEKEKREKIKRECEILKMTMNY

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS01855 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]