From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS02035 [old locus tag: SACOL0404 ]
  • pan locus tag?: SAUPAN001868000
  • symbol: SACOL_RS02035
  • pan gene symbol?: mepR
  • synonym:
  • product: multidrug efflux MATE transporter transcriptional repressor MepR

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS02035 [old locus tag: SACOL0404 ]
  • symbol: SACOL_RS02035
  • product: multidrug efflux MATE transporter transcriptional repressor MepR
  • replicon: chromosome
  • strand: +
  • coordinates: 410848..411267
  • length: 420
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (410848..411267) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGAATTCACTTATTCGTATTTATTTAGAATGATTAGTCATGAGATGAAACAAAAGGCT
    GATCAAAAGTTAGAGCAATTTGATATTACAAATGAGCAAGGTCATACGTTAGGTTATCTT
    TATGCACATCAACAAGATGGACTGACACAAAATGATATTGCTAAAGCATTACAACGAACA
    GGTCCAACTGTCAGTAATTTATTAAGGAACCTTGAACGTAAAAAGCTGATCTATCGCTAT
    GTCGATGCACAAGATACGAGAAGAAAGAATATAGGGCTGACTACCTCTGGGATTAAACTC
    GTAGAAGCATTCACTTCGATATTTGATGAAATGGAACAAACACTCGTATCGCAGTTATCT
    GAAGAAGAAAATGAACAAATGAAAGCAAACTTAACTAAAATGTTATCTAGTTTACAATAA
    60
    120
    180
    240
    300
    360
    420

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS02035 [old locus tag: SACOL0404 ]
  • symbol: SACOL_RS02035
  • description: multidrug efflux MATE transporter transcriptional repressor MepR
  • length: 139
  • theoretical pI: 6.26722
  • theoretical MW: 16172.2
  • GRAVY: -0.669784

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 40.9)
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 30)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 22.8)
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 20.4)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.8)
    Signal transductionRegulatory functionsDNA interactionsaminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 13.6)
  • TheSEED:
  • PFAM:
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 38.6)
    MarR; MarR family (PF01047; HMM-score: 38.1)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 22.9)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 21.2)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 20.3)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 18.4)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 17.8)
    no clan definedDUF445; Protein of unknown function (DUF445) (PF04286; HMM-score: 17.6)
    HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.2)
    HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 17.2)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.8)
    B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 16.5)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.3)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 15.2)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 15.2)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14.4)
    DUF1670; Protein of unknown function (DUF1670) (PF07900; HMM-score: 14.3)
    Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 13.1)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.7)
    no clan definedVps4_C; Vps4 C terminal oligomerisation domain (PF09336; HMM-score: 12.4)
    HTH (CL0123) HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.144
    • Ymax_pos: 21
    • Cmax: 0.135
    • Cmax_pos: 21
    • Smax: 0.293
    • Smax_pos: 20
    • Smean: 0.135
    • D: 0.14
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446319561 NCBI
  • RefSeq: WP_000397416 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS02035 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]