From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS03510 [old locus tag: SACOL0681 ]
  • pan locus tag?: SAUPAN002496000
  • symbol: SACOL_RS03510
  • pan gene symbol?: mnhC2
  • synonym:
  • product: cation:proton antiporter

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS03510 [old locus tag: SACOL0681 ]
  • symbol: SACOL_RS03510
  • product: cation:proton antiporter
  • replicon: chromosome
  • strand: +
  • coordinates: 706415..706759
  • length: 345
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (706415..706759) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAATTTAATATTATTACTAGTTATAGGATTTTTAGTGTTTATAGGAACATATATGATT
    TTATCAATCAATTTAATTCGTATTGTAATCGGAATTTCAATATATACTCATGCTGGTAAT
    CTCATTATTATGAGTATGGGAACGTATGGTTCTAGTAGATCAGAACCACTAATAACTGGT
    GGAAACCAATTGTTTGTTGATCCCTTGTTACAAGCTATTGTACTAACTGCAATAGTTATA
    GGGTTTGGGATGACTGCGTTTTTACTTGTACTTGTTTATAGAACTTATAAAGTAACAAAA
    GAAGATGAAATTGAAGGCCTAAGGGGGGAAGATGATGCTAAGTAA
    60
    120
    180
    240
    300
    345

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS03510 [old locus tag: SACOL0681 ]
  • symbol: SACOL_RS03510
  • description: cation:proton antiporter
  • length: 114
  • theoretical pI: 4.93178
  • theoretical MW: 12495.9
  • GRAVY: 0.886842

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsmulticomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 99.1)
  • TheSEED:
  • PFAM:
    no clan definedOxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 95)
    Ost4; Oligosaccaryltransferase (PF10215; HMM-score: 16.2)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.122
    • Ymax_pos: 11
    • Cmax: 0.127
    • Cmax_pos: 32
    • Smax: 0.249
    • Smax_pos: 1
    • Smean: 0.124
    • D: 0.123
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI: 446971729 NCBI
  • RefSeq: WP_001048985 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITGGNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS03510 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]