From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS03990 [old locus tag: SACOL0776 ]
  • pan locus tag?: SAUPAN002603000
  • symbol: SACOL_RS03990
  • pan gene symbol?:
  • synonym:
  • product: allophanate hydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS03990 [old locus tag: SACOL0776 ]
  • symbol: SACOL_RS03990
  • product: allophanate hydrolase
  • replicon: chromosome
  • strand: +
  • coordinates: 796518..797228
  • length: 711
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (796518..797228) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAATATATAGTCAAGGTGACCAAGCCATTGTAGTCGCAATTGAAAAAGAAGTATCT
    AAAAGTTTAACCGAAGATTTATTAACACTTCGCTCATATTTAATTGAACAAAATTATCCA
    TTTATTATAGAAATTGTGCCATCAGAATCAGACATGATGATTGTCTATGACGCAAGGGAT
    ATGATTAAACACCATAATATACAATCACCTTTTTTATACATGAAAGCACTAATAGAATCG
    ATTCATTTAAACATAAAACATGATTTTAACCAGCAAGATTTGATTGAAATACCAATTGTG
    TATGGTTCGAAATATGGTCCGGATTTAGAATCACTTTTAAAACATTACAAAATCAAGCTA
    GAAACTTTTATTGAATTACATTCTAAGGCGCAATATTTTGTTTCGATGATGGGATATTCA
    CCTGGGTTTCCTTATTTAACTGGATTAAATAAGAAATTGTATATTAATCACACGAGTAAA
    CAGAAAAAATTCATTCCAGCTGGTTCTGTAGTACTTGAAGGGAAAAAATGCGGTATTGTA
    ACTACGGATACAATTAATGATTGGTTAGTTATTGGTTATACACCATTATCACTTTTTAAT
    CCGAAAGAATCAGATTTCGCACGCTTAAAGTTAGGCGATAATATTAAATTTAGACCTATC
    AATGAAAATGAATTAGAAGTAGGAGCGTTTAAAGATGTCAATCATAATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    711

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS03990 [old locus tag: SACOL0776 ]
  • symbol: SACOL_RS03990
  • description: allophanate hydrolase
  • length: 236
  • theoretical pI: 6.72663
  • theoretical MW: 27123.2
  • GRAVY: -0.191525

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Hypothetical proteinsConservedsensor histidine kinase inhibitor, KipI family (TIGR00370; HMM-score: 142.4)
  • TheSEED:
  • PFAM:
    Cyclophil-like (CL0475) CT_C_D; Carboxyltransferase domain, subdomain C and D (PF02682; HMM-score: 139.1)
    no clan definedTINF2_N; TERF1-interacting nuclear factor 2 N-terminus (PF14973; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 23
    • Cmax: 0.116
    • Cmax_pos: 23
    • Smax: 0.109
    • Smax_pos: 65
    • Smean: 0.074
    • D: 0.09
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446631346 NCBI
  • RefSeq: WP_000708692 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKIYSQGDQAIVVAIEKEVSKSLTEDLLTLRSYLIEQNYPFIIEIVPSESDMMIVYDARDMIKHHNIQSPFLYMKALIESIHLNIKHDFNQQDLIEIPIVYGSKYGPDLESLLKHYKIKLETFIELHSKAQYFVSMMGYSPGFPYLTGLNKKLYINHTSKQKKFIPAGSVVLEGKKCGIVTTDTINDWLVIGYTPLSLFNPKESDFARLKLGDNIKFRPINENELEVGAFKDVNHN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS03990 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]