From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS04035 [old locus tag: SACOL0785 ]
  • pan locus tag?: SAUPAN002614000
  • symbol: SACOL_RS04035
  • pan gene symbol?:
  • synonym:
  • product: 5'-3'-deoxyribonucleotidase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS04035 [old locus tag: SACOL0785 ]
  • symbol: SACOL_RS04035
  • product: 5'-3'-deoxyribonucleotidase
  • replicon: chromosome
  • strand: +
  • coordinates: 808932..809474
  • length: 543
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (808932..809474) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGACCCGTAAATCAATCGCGATTGATATGGATGAAGTATTGGCAGATACATTAGGAGAA
    ATCATTGATGCTGTCAATTTTAGAGCGGATTTAGGTATTAAAATGGAAGCTTTGAATGGT
    CAAAAACTTAAACATGTTATTCCTGAACATGATGGATTAATTACAGAAGTATTGAGAGAA
    CCAGGCTTCTTCAGACATCTTAAAGTGATGCCGTATGCACAAGAAGTTGTGAAAAAATTA
    ACTGAACATTATGATGTATATATTGCTACAGCAGCAATGGATGTACCAACATCATTTAGT
    GATAAATATGAATGGTTACTAGAGTTCTTTCCATTTTTAGATCCTCAGCATTTTGTTTTT
    TGTGGTAGAAAAAACATCGTTAAAGCTGATTATTTAATAGATGACAATCCTAGACAGCTT
    GAAATTTTTACTGGTACACCGATTATGTTTACAGCAGTGCATAATATTAATGATGATCGA
    TTTGAACGCGTAAATAGCTGGAAAGATGTAGAACAGTATTTTTTAGATAATATTGAGAAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    543

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS04035 [old locus tag: SACOL0785 ]
  • symbol: SACOL_RS04035
  • description: 5'-3'-deoxyribonucleotidase
  • length: 180
  • theoretical pI: 4.71149
  • theoretical MW: 20986.9
  • GRAVY: -0.232222

Function[edit source | edit]

  • reaction:
    EC 3.1.3.-?  ExPASy
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    HAD (CL0137) NT5C; 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C) (PF06941; HMM-score: 121.3)
    NIF; NLI interacting factor-like phosphatase (PF03031; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.098
    • Ymax_pos: 30
    • Cmax: 0.156
    • Cmax_pos: 30
    • Smax: 0.103
    • Smax_pos: 42
    • Smean: 0.053
    • D: 0.08
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446119416 NCBI
  • RefSeq: WP_000197271 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTRKSIAIDMDEVLADTLGEIIDAVNFRADLGIKMEALNGQKLKHVIPEHDGLITEVLREPGFFRHLKVMPYAQEVVKKLTEHYDVYIATAAMDVPTSFSDKYEWLLEFFPFLDPQHFVFCGRKNIVKADYLIDDNPRQLEIFTGTPIMFTAVHNINDDRFERVNSWKDVEQYFLDNIEK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS04035 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]