From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS04855 [old locus tag: SACOL0947 ]
  • pan locus tag?: SAUPAN003044000
  • symbol: SACOL_RS04855
  • pan gene symbol?:
  • synonym:
  • product: thioesterase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS04855 [old locus tag: SACOL0947 ]
  • symbol: SACOL_RS04855
  • product: thioesterase
  • replicon: chromosome
  • strand: +
  • coordinates: 949971..950345
  • length: 375
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (949971..950345) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGACTCATTTATTAGAGACATTTGAGATGTCAATAGATCACCAGGAAGATGGTTTAGTT
    GTTATTTCTATGCCTGTTACTGATAAAGTAAAACAACCATTTGGATATTTACATGGTGGG
    GCTTCGATTGCTTTAGGTGAAACAGCATGTTCATTAGGATCTGCTAATTTAATTGATACA
    ACCAAATTTATTCCATTAGGTTTAGAGATGAATGCTAACCATATTCATTCTGCTAAAGAT
    GGTCGTGTTACTGCGACAGCTGAAATTATTCATCGAGGTAAGTCGACACATGTATGGGAT
    ATAAAAATTAAGAATGACAAAGAACAATTAATTACAGTTATGCGTGGTACAGTTGCTATT
    AAACCTTTAAAATAA
    60
    120
    180
    240
    300
    360
    375

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS04855 [old locus tag: SACOL0947 ]
  • symbol: SACOL_RS04855
  • description: thioesterase
  • length: 124
  • theoretical pI: 7.23489
  • theoretical MW: 13544.6
  • GRAVY: -0.0669355

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    uncharacterized domain 1 (TIGR00369; HMM-score: 99.9)
    phenylacetic acid degradation protein PaaD (TIGR02286; HMM-score: 38.9)
  • TheSEED:
  • PFAM:
    HotDog (CL0050) 4HBT; Thioesterase superfamily (PF03061; HMM-score: 53.7)
    DUF4442; Domain of unknown function (DUF4442) (PF14539; HMM-score: 21.5)
    4HBT_3; Thioesterase-like superfamily (PF13622; HMM-score: 17.9)
    GlnB-like (CL0089) CutA1; CutA1 divalent ion tolerance protein (PF03091; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.121
    • Ymax_pos: 47
    • Cmax: 0.112
    • Cmax_pos: 47
    • Smax: 0.162
    • Smax_pos: 51
    • Smean: 0.089
    • D: 0.108
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446071440 NCBI
  • RefSeq: WP_000149295 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTHLLETFEMSIDHQEDGLVVISMPVTDKVKQPFGYLHGGASIALGETACSLGSANLIDTTKFIPLGLEMNANHIHSAKDGRVTATAEIIHRGKSTHVWDIKIKNDKEQLITVMRGTVAIKPLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS04855 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]