From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS05000 [old locus tag: SACOL0977 ]
  • pan locus tag?: SAUPAN003109000
  • symbol: SACOL_RS05000
  • pan gene symbol?: sufT
  • synonym:
  • product: DNA methyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS05000 [old locus tag: SACOL0977 ]
  • symbol: SACOL_RS05000
  • product: DNA methyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 983375..983683
  • length: 309
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (983375..983683) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGGAAGAGGCATTGAAAGATAGTATCTTAGGTGCATTAGAAATGGTAATTGACCCTGAA
    TTAGGAATTGATATCGTTAATTTGGGTTTAGTATACAAAGTGAATGTTGATGATGAAGGC
    GTATGTACAGTTGATATGACTTTAACATCAATGGGATGTCCAATGGGACCTCAAATTATT
    GATCAAGTTAAAACAGTATTAGCAGAGATTCCTGAAATTCAGGATACTGAAGTGAATATC
    GTATGGAGTCCACCTTGGACAAAAGATATGATGTCACGTTACGCTAAGATTGCACTTGGT
    GTGAGCTAA
    60
    120
    180
    240
    300
    309

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS05000 [old locus tag: SACOL0977 ]
  • symbol: SACOL_RS05000
  • description: DNA methyltransferase
  • length: 102
  • theoretical pI: 3.77229
  • theoretical MW: 11153
  • GRAVY: 0.268627

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherprobable FeS assembly SUF system protein SufT (TIGR03406; HMM-score: 102.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly SUF system protein (TIGR02945; HMM-score: 101.7)
    MetabolismEnergy metabolismOtherphenylacetate-CoA oxygenase, PaaJ subunit (TIGR02159; HMM-score: 46.6)
  • TheSEED:
  • PFAM:
    NifU (CL0232) FeS_assembly_P; Iron-sulfur cluster assembly protein (PF01883; HMM-score: 73.8)
    PKinase (CL0016) Seadorna_VP7; Seadornavirus VP7 (PF07387; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 69
    • Cmax: 0.116
    • Cmax_pos: 37
    • Smax: 0.12
    • Smax_pos: 62
    • Smean: 0.074
    • D: 0.095
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446312720 NCBI
  • RefSeq: WP_000390575 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MEEALKDSILGALEMVIDPELGIDIVNLGLVYKVNVDDEGVCTVDMTLTSMGCPMGPQIIDQVKTVLAEIPEIQDTEVNIVWSPPWTKDMMSRYAKIALGVS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS05000 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]