From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS05440 [old locus tag: SACOL1067 ]
  • pan locus tag?: SAUPAN003267000
  • symbol: SACOL_RS05440
  • pan gene symbol?: qoxD
  • synonym:
  • product: quinol oxidase subunit 4

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS05440 [old locus tag: SACOL1067 ]
  • symbol: SACOL_RS05440
  • product: quinol oxidase subunit 4
  • replicon: chromosome
  • strand: -
  • coordinates: 1076196..1076486
  • length: 291
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1076196..1076486) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAGTACAATAATGAAACATACTGTAGGATTTATCGCATCTATCGTATTAACGCTTTTA
    GCAGTTTACGTAACACTATACACGTCATTAACATTCCACGCGAAGTTGACAATTATCTTT
    GGCTTTGCATTCGTCCAAGCAGGACTTCAATTATTAATGTTCATGCATTTAACTGAAGGT
    AAAGATGGACGTTTACAAACATTCAAAGTTATCTTTGCTCTTGTAATTACACTTTGTTTC
    GTTGTCGGAACATATTGGGTTATGCAAGGCGGTCACTCTTCACACTTATAA
    60
    120
    180
    240
    291

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS05440 [old locus tag: SACOL1067 ]
  • symbol: SACOL_RS05440
  • description: quinol oxidase subunit 4
  • length: 96
  • theoretical pI: 9.69391
  • theoretical MW: 10686.8
  • GRAVY: 1.01979

Function[edit source | edit]

  • reaction:
    EC 1.9.3.-?  ExPASy
    EC 1.10.3.-?  ExPASy
    Ubiquinol-8 + O2 = Ubiquinone-8 + H2O?
  • TIGRFAM:
    MetabolismEnergy metabolismElectron transportcytochrome aa3 quinol oxidase, subunit IV (TIGR02901; EC 1.10.3.-; HMM-score: 104.3)
    MetabolismEnergy metabolismElectron transportcytochrome o ubiquinol oxidase subunit IV (TIGR02847; EC 1.10.3.-; HMM-score: 55.5)
    MetabolismEnergy metabolismElectron transportcaa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 16.8)
    MetabolismEnergy metabolismElectron transportcytochrome c oxidase, subunit IVB (TIGR02908; EC 1.9.3.1; HMM-score: 15.5)
  • TheSEED:
  • PFAM:
    no clan definedCOX4_pro; Prokaryotic Cytochrome C oxidase subunit IV (PF03626; HMM-score: 45.5)
    Yip1 (CL0112) DUF1700; Protein of unknown function (DUF1700) (PF08006; HMM-score: 9.9)
    no clan definedPHO4; Phosphate transporter family (PF01384; HMM-score: 7.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.21
    • Ymax_pos: 11
    • Cmax: 0.214
    • Cmax_pos: 35
    • Smax: 0.497
    • Smax_pos: 6
    • Smean: 0.442
    • D: 0.301
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI: 446026399 NCBI
  • RefSeq: WP_000104254 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEGKDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS05440 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]