From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS05640 [old locus tag: SACOL1104 ]
  • pan locus tag?: SAUPAN003319000
  • symbol: SACOL_RS05640
  • pan gene symbol?: pdhC
  • synonym:
  • product: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS05640 [old locus tag: SACOL1104 ]
  • symbol: SACOL_RS05640
  • product: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  • replicon: chromosome
  • strand: +
  • coordinates: 1114254..1115546
  • length: 1293
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1114254..1115546) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    GTGGCATTTGAATTTAGATTACCCGATATCGGGGAAGGTATCCACGAAGGTGAAATTGTA
    AAATGGTTTGTTAAAGCTGGAGATACTATTGAAGAAGACGATGTTTTAGCTGAGGTACAA
    AACGATAAATCAGTAGTAGAAATCCCATCACCAGTATCTGGTACTGTAGAAGAAGTTATG
    GTAGAAGAAGGTACAGTAGCTGTAGTTGGTGACGTTATTGTTAAAATCGATGCACCTGAT
    GCAGAAGATATGCAATTTAAAGGTCATGATGATGATTCATCATCTAAAGAAGAACCTGCG
    AAAGAGGAAGCGCCAGCAGAGCAAGCACCTGTAGCTACTCAAACTGAAGAAGTAGATGAA
    AACAGAACTGTTAAAGCAATGCCTTCAGTACGTAAATACGCACGTGAAAAAGGTGTTAAC
    ATTAAAGCAGTTTCTGGATCTGGTAAAAATGGTCGTATTACAAAAGAAGATGTAGATGCA
    TACTTAAATGGTGGTGCACCAACAGCTTCAAATGAATCAGCTGCTTCAGCTACAAGTGAA
    GAAGTTGCTGAAACTCCTGCAGCACCTGCAGCAGTAACATTAGAAGGCGACTTCCCAGAA
    ACAACTGAAAAAATCCCTGCTATGCGTAGAGCAATTGCGAAAGCAATGGTTAACTCTAAG
    CATACTGCACCTCATGTAACATTAATGGATGAAATTGATGTTCAAGCATTATGGGATCAC
    CGTAAGAAATTTAAAGAAATCGCAGCTGAACAAGGTACTAAGTTAACATTCTTACCTTAT
    GTTGTTAAAGCACTTGTTTCTGCATTGAAAAAATACCCAGCACTTAACACTTCATTCAAT
    GAAGAAGCTGGTGAAATCGTTCATAAACATTACTGGAATATCGGTATTGCAGCAGACACT
    GATAGAGGATTATTAGTACCTGTTGTTAAACATGCTGATCGTAAGTCTATTTTCCAAATT
    TCAGATGAAATTAATGAATTAGCTGTTAAAGCACGTGATGGTAAATTAACAGCCGATGAA
    ATGAAAGGTGCTACATGCACAATCAGTAATATCGGTTCAGCTGGTGGACAATGGTTCACT
    CCAGTTATCAATCACCCAGAAGTAGCAATCTTAGGAATTGGCCGTATTGCTCAAAAACCT
    ATCGTTAAAGATGGAGAAATTGTTGCAGCACCAGTATTAGCATTATCATTAAGCTTTGAC
    CACAGACAAATTGATGGTGCAACTGGCCAAAATGCAATGAATCACATTAAACGTTTATTA
    AATAATCCAGAATTATTATTAATGGAGGGGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1293

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS05640 [old locus tag: SACOL1104 ]
  • symbol: SACOL_RS05640
  • description: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  • length: 430
  • theoretical pI: 4.63498
  • theoretical MW: 46382
  • GRAVY: -0.292093

Function[edit source | edit]

  • reaction:
    EC 2.3.1.12?  ExPASy
    Dihydrolipoyllysine-residue acetyltransferaseAcetyl-CoA + enzyme N6-(dihydrolipoyl)lysine = CoA + enzyme N6-(S-acetyldihydrolipoyl)lysine
  • TIGRFAM:
    MetabolismEnergy metabolismPyruvate dehydrogenasedihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 359)
    MetabolismEnergy metabolismTCA cycledihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 310.9)
    2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (TIGR02927; EC 2.3.1.61; HMM-score: 296.2)
    MetabolismEnergy metabolismPyruvate dehydrogenasepyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (TIGR01349; EC 2.3.1.12; HMM-score: 274.9)
    MetabolismTransport and binding proteinsOtherefflux pump membrane protein (TIGR00998; HMM-score: 22.3)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsoxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 18.4)
    MetabolismEnergy metabolismOtheroxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 18.4)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisacetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 17.3)
    MetabolismCentral intermediary metabolismNitrogen metabolismurea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 17.3)
    MetabolismTransport and binding proteinsUnknown substrateefflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 16.5)
    MetabolismEnergy metabolismAmino acids and aminesglycine cleavage system H protein (TIGR00527; HMM-score: 15.7)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesispyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 15.5)
    glycine cleavage protein H-like protein (TIGR03077; HMM-score: 14.9)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 12.2)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 12.2)
  • TheSEED:
  • PFAM:
    CoA-acyltrans (CL0149) 2-oxoacid_dh; 2-oxoacid dehydrogenases acyltransferase (catalytic domain) (PF00198; HMM-score: 298.9)
    Hybrid (CL0105) Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 84.1)
    no clan definedE3_binding; e3 binding domain (PF02817; HMM-score: 62.7)
    Hybrid (CL0105) Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 40.8)
    GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 20.5)
    HlyD_3; HlyD family secretion protein (PF13437; HMM-score: 17.7)
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 17.4)
    no clan definedATP-synt_ab_Xtn; ATPsynthase alpha/beta subunit N-term extension (PF16886; HMM-score: 15.6)
    Hybrid (CL0105) HlyD_D23; Barrel-sandwich domain of CusB or HlyD membrane-fusion (PF16576; HMM-score: 14.4)
    no clan definedDUF896; Bacterial protein of unknown function (DUF896) (PF05979; HMM-score: 13)
    HTH (CL0123) HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 12.9)
    TIM_barrel (CL0036) DUF2090; Uncharacterized protein conserved in bacteria (DUF2090) (PF09863; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: (R)-lipoate
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.091
    • Ymax_pos: 70
    • Cmax: 0.11
    • Cmax_pos: 27
    • Smax: 0.094
    • Smax_pos: 70
    • Smean: 0.058
    • D: 0.078
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446786184 NCBI
  • RefSeq: WP_000863440 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVMVEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDENRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASATSEEVAETPAAPAAVTLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDHRKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADTDRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFTPVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLLNNPELLLMEG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS05640 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]