From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS05765 [old locus tag: SACOL1129 ]
  • pan locus tag?: SAUPAN003347000
  • symbol: SACOL_RS05765
  • pan gene symbol?:
  • synonym:
  • product: regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS05765 [old locus tag: SACOL1129 ]
  • symbol: SACOL_RS05765
  • product: regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 1140193..1140627
  • length: 435
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1140193..1140627) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGATTAATGAAGCTTCACTAGCGATATTAGATGATATTGATGAACTAGCTGATATGATA
    GTTGCATCAGATATTTATGCATCATTTGAGCAAGCTAAACAGGCGCTCGAAAACAATGAC
    GAAGCACATTTACTTTATCAATCATTTTTAAAATCAAAAGAGAAATATGATGAAGTAATG
    CGATTCGGGAAATATCATCCTGATTATAAGAAAGTTATGTTAGAGACAAGACAACGCAAA
    AGAGCATATGAGATGCTTGACGTTGTGATGCATTACAAAGCTAGGGAAATGGCACTTCAA
    CATTTAATAGATGAAGTTGTTACGAAAATTGCGTACGCTGTTTCAGAACATGTCAAAATA
    GAAACAGGTAATCCATTCTTTCAAACATCACATAGTGGTTGTGCGACGGGCGGATCCTGT
    AATTGTTCATTATAA
    60
    120
    180
    240
    300
    360
    420
    435

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS05765 [old locus tag: SACOL1129 ]
  • symbol: SACOL_RS05765
  • description: regulator
  • length: 144
  • theoretical pI: 5.24638
  • theoretical MW: 16475.7
  • GRAVY: -0.35625

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 11.2)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 11.2)
    Genetic information processingProtein synthesisTranslation factorstranslation initiation factor IF-3 (TIGR00168; HMM-score: 10.4)
  • TheSEED:
  • PFAM:
    no clan definedCom_YlbF; Control of competence regulator ComK, YlbF/YmcA (PF06133; HMM-score: 58)
    IF3_C; Translation initiation factor IF-3, C-terminal domain (PF00707; HMM-score: 14.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.114
    • Ymax_pos: 36
    • Cmax: 0.145
    • Cmax_pos: 28
    • Smax: 0.182
    • Smax_pos: 32
    • Smean: 0.068
    • D: 0.096
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446529134 NCBI
  • RefSeq: WP_000606480 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MINEASLAILDDIDELADMIVASDIYASFEQAKQALENNDEAHLLYQSFLKSKEKYDEVMRFGKYHPDYKKVMLETRQRKRAYEMLDVVMHYKAREMALQHLIDEVVTKIAYAVSEHVKIETGNPFFQTSHSGCATGGSCNCSL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS05765 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]