From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003347000
  • symbol?:
  • description?: regulator

      descriptions from strain specific annotations:

    • regulator
    • regulatory protein YlbF
    • ComK regulator
    • vacuolating cytotoxin paralog
  • strand?: +
  • coordinates?: 3715085..3715519
  • synteny block?: BlockID0024310
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1076
    08BA02176:
    C248_1146
    11819-97:
    MS7_1076
    71193:
    ST398NM01_1116
    ECT-R 2:
    ECTR2_974
    ED133:
    SAOV_1061
    ED98:
    SAAV_1086
    HO 5096 0412:
    SAEMRSA15_09490
    JH1:
    SaurJH1_1201
    JH9:
    SaurJH9_1179
    JKD6008:
    SAA6008_01074
    JKD6159:
    SAA6159_00974
    LGA251:
    SARLGA251_10320
    M013:
    M013TW_1051
    MRSA252:
    SAR1093
    MSHR1132:
    SAMSHR1132_09660
    MSSA476:
    SAS1054
    Mu3:
    SAHV_1111
    Mu50:
    SAV1119
    MW2:
    MW1002
    RF122:
    SAB0984
    ST398:
    SAPIG1116
    T0131:
    SAT0131_01158
    TCH60:
    HMPREF0772_12113 (ylbF)
    TW20:
    SATW20_11140
    USA300_TCH1516:
    USA300HOU_1058
    VC40:
    SAVC_04760

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINEASLAILDDIDELADMIVASDIYASFEQAKQALENNDEAHLLYQSFLKSKEKYDEVM
    N315            MINEASLAILDDIDELADMIVASDIYASFEQAKQALENNDEAHLLYQSFLKSKEKYDEVM
    NCTC8325        MINEASLAILDDIDELADMIVASDIYASFEQAKQALENNDEAHLLYQSFLKSKEKYDEVM
    USA300_FPR3757  MINEASLAILDDIDELADMIVASDIYASFEQAKQALENNDEAHLLYQSFLKSKEKYDEVM
                    ************************************************************

    COL             RFGKYHPDYKKVMLETRQRKRAYEMLDVVMHYKAREMALQHLIDEVVTKIAYAVSEHVKI
    N315            RFGKYHPDYKKVMLETRQRKRAYEMLDVVMHYKAREMALQHLIDEVVTKIAYAVSEHVKI
    NCTC8325        RFGKYHPDYKKVMLETRQRKRAYEMLDVVMHYKAREMALQHLIDEVVTKIAYAVSEHVKI
    USA300_FPR3757  RFGKYHPDYKKVMLETRQRKRAYEMLDVVMHYKAREMALQHLIDEVVTKIAYAVSEHVKI
                    ************************************************************

    COL             ETGNPFFQTSHSGCATGGSCNCSL
    N315            ETGNPFFQTSHSGCATGGSCNCSL
    NCTC8325        ETGNPFFQTSHSGCATGGSCNCSL
    USA300_FPR3757  ETGNPFFQTSHSGCATGGSCNCSL
                    ************************