From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002220000
  • symbol?:
  • description?: signal peptidase II

      descriptions from strain specific annotations:

    • signal peptidase II
    • Stage 0 sporulation protein YaaT
    • phosphorelay inhibitor
    • PSP1 C-terminal conserved region family protein
    • PSP1 domain-containing protein
    • signal peptidase II-like protein
    • Signal peptidase-like protein
  • strand?: +
  • coordinates?: 2732833..2733636
  • synteny block?: BlockID0015190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0460
    08BA02176:
    C248_0539 (yaaT)
    11819-97:
    MS7_0462
    71193:
    ST398NM01_0551
    ECT-R 2:
    ECTR2_425
    ED133:
    SAOV_0506
    ED98:
    SAAV_0431
    HO 5096 0412:
    SAEMRSA15_04110
    JH1:
    SaurJH1_0519
    JH9:
    SaurJH9_0506
    JKD6008:
    SAA6008_00489
    JKD6159:
    SAA6159_00436
    LGA251:
    SARLGA251_04190
    M013:
    M013TW_0454
    MRSA252:
    SAR0486
    MSHR1132:
    SAMSHR1132_04290
    MSSA476:
    SAS0442
    Mu3:
    SAHV_0482
    Mu50:
    SAV0485
    MW2:
    MW0440
    RF122:
    SAB0434
    ST398:
    SAPIG0551
    T0131:
    SAT0131_00530 (ribD)
    TCH60:
    HMPREF0772_10036
    TW20:
    SATW20_05530
    USA300_TCH1516:
    USA300HOU_0484
    VC40:
    SAVC_02010

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPNVIGVQFQKAGKLEYYTPNDIQVDIEDWVVVESKRGIEIGIVKNPLMDIAEEDVVLPL
    N315            --------------------------------------------------------MLPL
    NCTC8325        MPNVIGVQFQKAGKLEYYTPNDIQVDIEDWVVVESKRGIEIGIVKNPLMDIAEEDVVLPL
    Newman          MPNVIGVQFQKAGKLEYYTPNDIQVDIEDWVVVESKRGIEIGIVKNPLMDIAEEDVVLPL
    USA300_FPR3757  MPNVIGVQFQKAGKLEYYTPNDIQVDIEDWVVVESKRGIEIGIVKNPLMDIAEEDVVLPL
                                                                            :***

    COL             KNIIRIADDKDIDKFNCNERDAENALILCKDIVREQGLDMRLVNCEYTLDKSKVIFNFTA
    N315            KNIIRIADDKDIDKFNCNERDAENALILCKDIVREQGLDMRLVNCEYTLDKSKVIFNFTA
    NCTC8325        KNIIRIADDKDIDKFNCNERDAENALILCKDIVREQGLDMRLVNCEYTLDKSKVIFNFTA
    Newman          KNIIRIADDKDIDKFNCNERDAENALILCKDIVREQGLDMRLVNCEYTLDKSKVIFNFTA
    USA300_FPR3757  KNIIRIADDKDIDKFNCNERDAENALILCKDIVREQGLDMRLVNCEYTLDKSKVIFNFTA
                    ************************************************************

    COL             DDRIDFRKLVKILAQHLKTRIELRQIGVRDEAKLLGGIGPCGRSLCCSTFLGDFEPVSIK
    N315            DDRIDFRKLVKILAQHLKTRIELRQIGVRDEAKLLGGIGPCGRSLCCSTFLGDFEPVSIK
    NCTC8325        DDRIDFRKLVKILAQHLKTRIELRQIGVRDEAKLLGGIGPCGRSLCCSTFLGDFEPVSIK
    Newman          DDRIDFRKLVKILAQHLKTRIELRQIGVRDEAKLLGGIGPCGRSLCCSTFLGDFEPVSIK
    USA300_FPR3757  DDRIDFRKLVKILAQHLKTRIELRQIGVRDEAKLLGGIGPCGRSLCCSTFLGDFEPVSIK
                    ************************************************************

    COL             MAKDQNLSLNPTKISGACGRLMCCLKYENDYYEEVRAQLPDIGEAIETPDGNGKVVALNI
    N315            MAKDQNLSLNPTKISGACGRLMCCLKYENDYYEEVRAQLPDIGEAIETPDGNGKVVALNI
    NCTC8325        MAKDQNLSLNPTKISGACGRLMCCLKYENDYYEEVRAQLPDIGEAIETPDGNGKVVALNI
    Newman          MAKDQNLSLNPTKISGACGRLMCCLKYENDYYEEVRAQLPDIGEAIETPDGNGKVVALNI
    USA300_FPR3757  MAKDQNLSLNPTKISGACGRLMCCLKYENDYYEEVRAQLPDIGEAIETPDGNGKVVALNI
                    ************************************************************

    COL             LDISMQVKLEGHEQPLEYKLEEIETMH
    N315            LDISMQVKLEGHEQPLEYKLEEIETMH
    NCTC8325        LDISMQVKLEGHEQPLEYKLEEIETMH
    Newman          LDISMQVKLEGHEQPLEYKLEEIETMH
    USA300_FPR3757  LDISMQVKLEGHEQPLEYKLEEIETMH
                    ***************************