From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS06065 [old locus tag: SACOL1185 ]
  • pan locus tag?: SAUPAN003437000
  • symbol: SACOL_RS06065
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS06065 [old locus tag: SACOL1185 ]
  • symbol: SACOL_RS06065
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1191117..1191305
  • length: 189
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1191117..1191305) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAGAAATCAAATTCAAAAACTATTAGACAGTGATTTGAGCAGTTTACATATATCGAAA
    CAAACAGGAGTTCCACAAAGCACAATACACAGAATGAGAAAAAATGAAAGATCATTAGAC
    AATATGTCATTGAAAAACGCTGAACTACTTTATAAATTTGCCAATAGTATATTTAGCAAT
    GAAAATTAA
    60
    120
    180
    189

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS06065 [old locus tag: SACOL1185 ]
  • symbol: SACOL_RS06065
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.3639
  • theoretical MW: 7192.13
  • GRAVY: -0.770968

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneralTrpR homolog YerC/YecD (TIGR02531; HMM-score: 15.8)
  • TheSEED:
  • PFAM:
    HTH (CL0123) Trp_repressor; Trp repressor protein (PF01371; HMM-score: 16.1)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 15.8)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.1)
    CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 13.8)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.166
    • Ymax_pos: 13
    • Cmax: 0.121
    • Cmax_pos: 32
    • Smax: 0.366
    • Smax_pos: 11
    • Smean: 0.279
    • D: 0.21
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447168546 NCBI
  • RefSeq: WP_001245802 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MRNQIQKLLDSDLSSLHISKQTGVPQSTIHRMRKNERSLDNMSLKNAELLYKFANSIFSNEN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS06065 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]